KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0367700-01Help
Entry
Os09t0367700-01   CDS       T02163                                 

Gene name
Os09g0367700, GSTU5, TAU_GLUTATHIONE_S-TRANSFERASE_5
Definition
(RAP-DB) Similar to GST6 protein (EC 2.5.1.18).
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Os09t0367700-01 (Os09g0367700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Os09t0367700-01 (Os09g0367700)
Transporters [BR:dosa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Os09t0367700-01 (Os09g0367700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
LinkDB All DBs
Position
chr09:complement(12120539..12121240)
AA seq 233 aa AA seqDB search
RRRPAMADEVVLLDLWVSPFGQRCRIALAEKGVEYEYSEQSLADKSDLLLRSNPVHKKVP
VLLHAGRPVCESLVILEYIDETWPPEPEKKKESPRLLPSDPYARARARFWADYVDKKLFD
CQTRLWKLRAGDAAHEQAKRDMAEALGTLEAELGEGDYFGGEAFGYLDVVLVPFVAWFHA
YERLAGFAVAEICPRLVAWGERCKGRDSVAKTLTDPEKVYEFALYLKAKFGAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
cggcgccggccggcaatggcggacgaggtggtgctcctggacttgtgggtgagcccgttc
gggcagcgttgccggatcgcgcttgcggagaagggcgtggagtacgagtacagcgagcag
agcctcgccgacaagagcgacctcctcctccgctccaaccccgtccacaagaaggtcccc
gtcctcctccacgccggccgccccgtctgcgagtccctcgtcatcctcgagtacatcgac
gagacatggccgccggagccggagaagaagaaggagtcgccgcgtctcctccccagcgac
ccctacgcccgcgcgcgtgccaggttctgggcggactacgtcgacaagaagctgttcgac
tgccagacacgcctctggaagctcagggccggcgacgccgcgcacgagcaggccaagagg
gacatggcggaggcgctggggacgctggaggcggagctcggggagggggactacttcggc
ggcgaggcgttcggctacctcgacgtcgtgctcgtgccgttcgtggcgtggttccacgcc
tacgagaggctcgcgggattcgccgtggcggagatctgcccgcggctggtggcgtggggg
gaacgatgcaaggggagggacagcgtcgccaagacgcttactgatcctgagaaggtgtac
gagttcgcgctctacctcaaggccaagtttggcgccaagtag

DBGET integrated database retrieval system