KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0613100-00Help
Entry
Os12t0613100-00   CDS       T02163                                 

Gene name
Os12g0613100
Definition
(RAP-DB) Similar to Amino acid permease family protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease AA_permease_C AA_permease_2
Motif
Other DBs
RAP-DB: Os12t0613100-00
LinkDB All DBs
Position
chr12:complement(join(25963710..25964140,25962044..25962415,25960810..25961854))
AA seq 615 aa AA seqDB search
NGSHGGGGGRRRGAAARGVLRRRGRRRGVVPGGVVRELGRVREGADGDGAAAGGAADGEV
GGGGGGERGEGAERRGDEEEPDVVGPRLVRRRRRHRRRHLRAHGAGGQGRRRPRRRALLR
RLRRLRHALRLVLHRVRHRDPRRRWVVRLPASGAGRLRGVHRRRQHPPRVLHRRRGGGAR
VDVLLRHPPQPPPQRLPHPRRLPRRRLLPPRPHRRRRHRRRLRPLRPQHQGLLPLQLRPL
HRPPRRPRLHRHRRPLKVGVQEGLSVNPARLSNLTADFAPFGARGVFAASAVLFFAYVGF
DAVSTMAEETRDPARDIPAGLVGAMAVTTAAYCALAATLCLMQPYREIDPDAPFSVAFSA
AGMGWARYVVAFGALKGMTTVLLVSAVGQARYLTHIARAHMAPPCLARVHPRLGTPVNAT
VAMLAATAAIALFTDLGVLANLLSISTLFIFMLVAVALLVRRYYATGETARGDRNRLAGC
LAVIVASSVATAAYWGLGGDGGGWAAYAVAVPAWLAATLFLQLRVPMARTPEKWGVPLVP
WLPSASIFINIFLLGSIDGRSFMRFGVWTAALLAYYFFFGLHASYDTAKALAAEVAAGKV
EEGGSKPAVGGAAGN
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
aatggcagccatggcggaggcggcggccggcggcgaggtgcggcggcgaggggggtgctg
cggcggcgggggaggcggcggggggttgttcccggaggagtcgttcgcgagctggggcgc
gtacgggagggcgctgatggagacggggccgcggctggtggagcggccgacggcgaggtc
ggcggcggcggtggaggtgaacgaggtgagggggcggagcggcgcggagatgaagaggaa
cctgacgtggtgggacctcgcctggttcggcgtcggcgccgtcatcggcgccggcatctt
cgtgctcacggggcaggaggccagggacgccgccggccccgccgtcgtgctctcctacgc
cgtctccggcgtctccgccatgctctccgtcttgtgctacaccgagttcgccatcgagat
ccccgtcgccggtgggtcgttcgcttacctgcgagtggagctgggcgacttcgtggcgtt
catcgccgccggcaacatcctcctcgagtactgcatcggcggcgcggcggtggcgcgcgc
gtggacgtcctacttcgccaccctcctcaaccaccgccccaacgacttccgcatccacgc
cgcctccctcgccgccgactactcccgcctcgaccccatcgccgtcgccgtcatcgccgt
cgtctgcgccctctccgtcctcagcaccaaggcctcctcccgcttcaactacgccctctc
catcgcccacctcgccgtcctcgtcttcatcgtcaccgccggcctctcaaggtaggggtg
caagagggtttatccgtgaacccggccaggctctccaacctcaccgccgacttcgccccc
ttcggcgcccgcggcgtgttcgcggcgtcggcggtgctcttcttcgcgtacgtggggttc
gacgccgtcagcaccatggcggaggagacccgggacccggcgagggacatccccgcgggg
ctcgtcggcgccatggcggtcaccacggcggcgtactgcgccctcgccgccacgctctgc
ctcatgcagccctaccgcgagatcgaccccgacgcgcccttctccgtcgcgttctccgcc
gccggcatggggtgggcaaggtacgtggtggcgttcggcgcgctcaaggggatgaccacc
gtgctgctcgtcagcgccgtcgggcaggcgaggtacctgacgcacatcgcgagggcgcac
atggcgccgccgtgcctcgcccgggtgcacccgaggctggggacgccggtgaacgccacg
gtggccatgctcgccgcgacggcggccatcgcgctgttcaccgacctcggcgtcctcgcc
aacctcctctccatctccacgctcttcatcttcatgctcgtcgccgtcgcgctgctcgtc
cgccgctactacgccaccggcgagacggcgcgcggagaccggaacaggctcgccggctgc
ctcgccgtgatcgtggcgtcgtcggtcgcgacggcggcgtactgggggctgggcggcgac
ggcggcgggtgggcggcgtacgcggtggccgtgccggcgtggctcgcggcgacgctgttc
ctgcagctgagggtgccgatggcgaggacgccggagaagtggggggtgccgctggtgcca
tggctgccgtcggcgtccatcttcatcaacatcttcctcctcggctccatcgacggcagg
tcgttcatgcggttcggggtctggacggcggcgctgctcgcctactacttcttcttcggc
ctgcacgcctcctacgacaccgccaaggcgctcgccgccgaggtcgccgccggcaaggtg
gaggaaggcggcagcaagccggcggtcggcggcgccgccggcaactga

DBGET integrated database retrieval system