KEGG   Dendroctonus ponderosae (mountain pine beetle): 109536457Help
Entry
109536457         CDS       T04899                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    109536457
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    109536457
Enzymes [BR:dpa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109536457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 204 aa AA seqDB search
MILTLTCLVLSTIYQVRSTEVVLREAVATIQGNGTNSVSGGVYFKETPSGSVEVSGTVTG
LTSGLHGFHVHMYGDLTNGCLSTADHYNPHNVAHGGKNASTRHVGDLGNIDGGQTGTASI
QIIDSVISLSGPHSIIGRAVVIHQDEDDLGLGGHEDSLTTGRAGPRIGCGVIGMLGDPIS
ASHQVLPAMMTTLAMLLTAGRLLR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaactttgacctgcctggtattatcaactatctaccaggtgcgatcaactgaa
gtggtgctgagagaagctgtagctaccatacagggcaatggcaccaactccgtaagcggc
ggtgtgtacttcaaggaaactccatccgggtctgtagaagtttccggaaccgtgaccggc
ctgacttccggattgcacgggtttcacgtccacatgtacggcgatctgaccaacggatgt
ttgtctactgctgaccactacaatccgcataacgtggcacatgggggcaaaaatgcaagc
acacgccacgtgggcgacctgggaaacatcgatggtgggcaaacaggcacagcctcaatc
cagatcatcgattccgtaatttctttgagcggaccccatagcataattgggcgggcggtg
gttattcatcaagacgaagacgatttgggtttaggaggacatgaagattcgttgaccaca
ggacgcgcagggcccaggatcgggtgtggagtgatcggaatgttgggcgatcccatttcg
gcttcccatcaagtgctgcctgcaatgatgaccaccttagcaatgttactcacagcaggg
aggcttttgcgttaa

DBGET integrated database retrieval system