KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537454Help
Entry
109537454         CDS       T04899                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109537454
Peptidases [BR:dpa01002]
 Metallo Peptidases
  Family M2
   109537454
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109537454
CD molecules [BR:dpa04090]
 Proteins
  109537454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 435 aa AA seqDB search
MKDLYANVKICPFIPNEQKTDQVYCDLELMDAQKLMTKSANHLELLHVWEEWHDKTGPPM
RNKFMRYVDLANQAAQLNGFGNAGEEMGSIYEADDFQDELAETFQKILPLYKQLFAYVRS
KLHKHYGPDVVRPNGPLPAHILGNLWAQEWSKIYHIVAPYPEFGNIDVTDELLQQGFTPL
RIFQMTEEFYTSMGLKPMPPEFWRFSMIEKPNSRKVQCTASAWDFCNKVDYRIKQCTEVN
MDNLVTTYHEMAHIEYYLHYAGQPYLYRDGANPGFHEGVANAVLLSVFNPKHFYRMGLSS
NNTEVYERNMNFLMLMALKKVAYASFAYLVDQWRYTIFEHGVSKMNSDWWNFRLRYQGIV
PPIPRSESHFDAAAKRHIPADVPYIKYYVALLLEFQIYKSMCDAANHKGSLHTCDVYRSR
EAGRVLSDILRVGKA
NT seq 1304 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttatacgcaaatgtgaaaatctgcccgttcattccaaacgagcagaaaacg
gatcaagtgtattgcgacttggaactgatggacgcccagaagctgatgacaaaatcggcc
aaccatctggaactgttgcatgtatgggaagaatggcacgataaaactggtcctccgatg
cgcaataaattcatgcgatacgtggatctggctaatcaagcggcgcaactaaacggcttt
gggaacgcgggtgaagaaatggggtccatctatgaagcagacgattttcaggacgaacta
gcggagaccttccagaaaatcctgccgctctacaagcagctgtttgcgtatgtgcgatcg
aagctgcacaaacattatgggccggacgttgttaggcccaatgggcccctaccagcgcat
attttgggcaacttatgggcgcaggaatggagcaagatctaccacattgttgccccgtat
ccagagtttggcaacattgatgtgaccgatgaactattgcagcaaggattcactccttta
aggatatttcagatgaccgaggagttctacacatcaatggggctcaagccgatgccgccc
gagttttggaggttttcaatgatcgaaaagcccaactcccgaaaggtgcaatgcacggcc
agcgcatgggatttttgcaacaaagtcgactaccggatcaaacagtgcactgaggtgaac
atggacaacctggtcaccacctatcatgagatggctcatattgagtactacttgcactat
gcaggccagccctacttgtacagagatggcgcaaatccaggatttcacgagggcgtagcc
aatgctgtgttgctatcggtattcaacccgaagcatttctaccgcatgggcctgagcagt
aacaacacggaagtttacgagcgcaacatgaacttcctaatgctgatggcgttgaagaaa
gttgcgtatgcctcatttgcttatctggtggatcagtggcgatacacgattttcgagcat
ggcgtatccaagatgaactcagattggtggaactttcgactccgataccaaggcatcgtg
cctccgattccgcgctcagaaagccactttgatgccgctgctaaacggcacattcctgca
gacgtcccttacatcaagtactacgttgccttacttttggagttccaaatatacaaatca
atgtgcgacgcggccaatcacaagggatccctgcacacctgcgatgtgtacagatccagg
gaagccggccgagtattaagtgatattcttcgcgtcggcaaggc

DBGET integrated database retrieval system