KEGG   Dendroctonus ponderosae (mountain pine beetle): 109540203Help
Entry
109540203         CDS       T04899                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ash1 isoform X1
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109540203
Enzymes [BR:dpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109540203
Chromosome [BR:dpa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109540203
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2252 aa AA seqDB search
MAGNDGTTTELFTGWSSVVHQPEDEPEESELPSTVDIGALSAEPPEPSQKQDEAESDSES
EDSEADSSNSDASASQESCSHSDSSDSDSSSSSQESTSRSPSPEFSVTSTQTNGLRLTIA
TVRKSISSPVNTAKRSLGPNKNQGKKKSDRKSSTSSCSNCSSDSDDSNDSDNKSEAKKQP
GGRKAAPAVKGRLVNSATTKSCKEPEKAKQSPVATKNRAPATQMALKEGSIPKLKLSSSG
SSIASGTKDQKPLALRDKEAVLNKSRISSSSNLRDAALPKTRSNTKDREPAPKDKERDAG
VVGKLRSSAAVNASSKDLQKTRSANSAKISAKEQENPDHTPKAPTGNLKPQNASLNDSHK
GSTKDRSAGKDEGTNSSKASRKKVRMKKRAKKMASLPLSRSSTYSSSDSESSDDLLPASC
SLQEIRQEDLAAILPDQNECNDFNDFDENNKDSPATGDMSGSDMELPQQAINSLIQRTTE
SSSDGEGHQLPNPQTLFANSLLQQFVPNSPLVGPNGNSHLAVSIGESLSAGATSSGAAGA
HAMSSKSSDHASSALNCEVSADAPSVKRGRGRPRRENGARKHKEDMLKTMRGAGEKGLQD
FCGGPNVSPDSGIQNSPDHVSSPEPSLSPNPRLKHSALIKDEQKKSLCSSRRSKLEHLNS
RPSSTERHSKRILSQASQERQVKLDERASRRSKMPEAQKAPEVPSQGKPNIIKLNQEKGS
ARKTSREQRRQLSRNSGSSRASSLEKAKEPVTKVPLTCNQLDRVLCANTDRVLYPPRRKV
GRPPIRRPGRPPKHRVETSECKGPSDKPLLPPKGKSRIRLSSNAAQPTKPNANQNKAVSL
QVPKILHSKHSQRHKKRKFKIFKSVVSSDPKIHQEIEKLVGDFSKFCVIGSKQTKEAAAE
PAVKTLKKVAKKRRTTDYVEKKKRKQSVNATVDKVANSIEQRLPLKKRHYHLVSNGSENQ
ATELGEQEETPAEPQDQSKAKAEKKEKGKEKDCKGLSKCANALKNHTNNNQYEVKVEKEA
SSHIEEAIEACIHKFSEEKVPKPDDTENKSVMATTPKKRHRLENFQELSSSLPEIKTEVS
CSGNEDTLEKLKSSVTVESYINELKIKRNLMAQLPEDNNAAQPEHGEEPKIKKEASATVQ
VEKTVPVSPESTKKKVRKRRAYNRTGFPTIKRKKKKPISTSNLQATVVDIDDMPICDRVP
KEGEEITKFLQRSSRANSSTPDLVRANLEVLDEVSECESLPQDERIDCDEDGDSSRCESV
VDNLSDSRNKSDIADSETLSLLEFSIERLKSRLHQKTRKRNRDTRPLAEKANIYPKRRKR
ECSPASSVEPLLENRLRDSASASGDELSKKSKKAPKWKKKYLPAGLFSDFFKEEESKRQD
AAKSSRILAYNAEDHPFGLLPPPYHCGRSLRRKMVDFQLPFDLWWQHTHSQLPGRDLVPS
WNYRKIRTNVYNVKTNGGSCEPQSCNCKSTSDCDDDCINRLVLAECPTSHRCNNQRIQKH
DWAPGIEKFMTEDKGWGVRTKEPINQGDFILEYVGEVVSDQEFKERMNSIYVNDTHHYCL
HLDSGLVIDGHRMGGDGRFVNHSCEPNCEMQKWSVNGQFRMALFALRNIQPFEELSYDYN
FSLFNPAEGQPCKCRSAQCRGVIGGKTQRIKQLPESTVPKNPGRVGRPRKTEAKKKPNSQ
KDNSATSTTVPPITQVVPQIQVKPMSHQQKCFILEHHCFLLRNLTKVRKVRDRSLSVTSN
TIARLHTATPTDTSTFINQLNAIQKPRNMKTRKVAQAEDDPELNKTIKLATVLKNILSGL
ADLKGDKDESLSSHLYQLPSKRKLPEFFQKVQDPIDLSTIEQKVATGVYKTPEAFDMDMI
KLFSGFAKFYGRNSDVGIAVAKLKKLYMATKQNNLPKLEGVLGNKPPPAFANCKKTNHEE
DIIRCICGIPRDEGLMIQCERCMVWQHIECVKADASVASYHCEVCVPRPIDYEIPMDDFT
EHGHRYYMTLMRGDLQLRQGDTVYVLRDIPIPGSDRKHTYETIGKIDYSELDIFRVERLW
KDKDSGKRFAYGHHYLRPHETFHEPTRKFFSNEVMRVPLYEAVPVELVMEHCWVMDINTF
CKGRPIGAQEEHVYICEYRVDKGAKMFSKVAKSKFPICTKSFAFEQFETRMKISRTYCPH
DVDASLLKNGGVGRRRLDKDKEKLSSNEGAAQVAAAQLQSAPVPIQRSPAQQKARLNKIL
LNLLSKMPTKQIVDVSYLLEGGRRRKKQETKQ
NT seq 6759 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaatgatggcaccacaactgaactgtttacgggatggtcgtcggttgtccat
cagcccgaggacgagccagaagaatcggaactgccatccactgttgatatcggagcgctt
agcgctgagccgcctgagcccagccaaaagcaagatgaagctgagagcgattcggaaagc
gaagattccgaagcggattccagtaactcggatgctagtgcgtcgcaggaatcgtgctcg
catagcgacagctcagacagcgacagttcctccagttctcaggagtcaacgtctcgatcc
cccagcccggagttttcggtaaccagcactcagaccaacggcttgcggctgacaatagcg
accgttaggaagagcatcagcagccccgtcaacacggcgaagcgaagcttgggccccaat
aagaaccagggcaagaagaagtcggacaggaaaagctccactagtagctgctcgaattgc
tcgagcgactccgacgatagcaacgattcggataataaaagcgaagccaagaagcagcca
ggtgggcgaaaggctgcaccggctgttaaagggcggttggtcaacagcgcaaccaccaaa
agctgcaaggagccggaaaaagccaagcaaagcccggtagcgactaaaaatcgcgctcca
gccactcaaatggcgctaaaagagggctcgattccaaagctaaagctttcttccagcggc
agcagcattgcgagtggaaccaaagaccagaagccgttggcattgcgggataaggaagca
gtattaaacaaaagtagaatctcatcgagcagcaatctcagagacgccgctctgcccaaa
acaagaagcaacaccaaggatagagagccggctcccaaagacaaggaacgggacgcgggt
gttgttggaaagctccgaagctctgccgcagtaaatgcaagcagcaaagacctgcagaag
accaggagcgctaattcagcaaaaatcagcgctaaggagcaggaaaaccctgaccacacg
cccaaggcccccactggcaatttgaagcctcaaaatgccagtttgaatgattcccacaaa
ggctccaccaaggaccgaagtgctgggaaggatgaaggcaccaacagctcgaaagccagc
cggaaaaaagtcaggatgaagaaacgagccaagaagatggcctcattgccactgtcccgc
agctcgacttattcgagttcagattccgagtcctctgatgatctgctgccggcttcttgc
agcctacaggagatccggcaggaagatctggctgctatcttgcccgaccaaaacgagtgc
aacgacttcaatgatttcgacgagaacaacaaggattcacccgccactggcgatatgtcc
ggttcggacatggaactcccacagcaggccatcaactccttgatccagcggaccaccgaa
tcctcaagcgacggggaaggccatcaacttcctaaccctcaaacgctgttcgccaacagc
ctgttgcagcagttcgtgcccaacagtcctctggttggccccaatggaaactcacatctg
gcagtttccattggagagtcactgagtgctggcgctacttcttctggggccgctggcgct
catgcaatgtccagtaaatcttccgatcatgccagttcagccttgaactgtgaggtgagt
gcggacgctcccagtgtgaaaagaggacgaggcaggccaagacgagaaaacggagcgcgc
aagcataaggaagacatgctgaagaccatgagaggggctggggaaaaaggcttgcaggac
ttctgtgggggcccgaacgtcagccccgactccggcattcagaacagcccagatcacgtt
tccagtcctgagccctcgctgtctcccaatccgcgcctgaaacattcagcgctcatcaaa
gatgagcagaaaaagtctctgtgctcttcccgaaggtccaagttggagcatttgaattcc
agaccttcatccacggagcggcactcaaaacgcattctctctcaagcttcacaagagcgt
caagtgaagctggatgaaagggcttctcgcagaagcaaaatgccggaggctcaaaaggcc
cccgaagtgccatcacaggggaaacccaacataatcaagctcaatcaggagaagggctcc
gcccgaaagacttctcgcgaacaaagaaggcaactgagcagaaactctggttcaagcaga
gcttcttctcttgagaaagcgaaagagcctgtaactaaagtgccgttaacgtgcaaccaa
ttggatcgggttttgtgcgctaacaccgacagagttctgtatccaccgaggaggaaagtg
ggaaggccgccgatcaggcggccaggaagaccgcccaagcacagggtggaaacttccgag
tgcaaaggcccttccgacaaacccctattgcctcccaagggtaaatctagaatccgacta
tcgtccaacgccgcacagccaacgaagccaaacgccaatcaaaacaaggctgtgtctctt
caagtgcccaagatcctgcactccaagcactcccagagacacaagaagcggaaatttaaa
attttcaagtcggttgtgtcgtctgacccgaaaattcaccaagaaattgaaaagttggtc
ggggatttttccaagttttgcgtcattggctcgaagcaaacgaaggaagctgctgctgag
ccagcggtgaagacattgaagaaagtcgccaagaagagacgaacaactgactatgtggaa
aagaaaaagcgaaagcagagcgtgaatgccacagtggataaggttgcaaactccatcgaa
cagcggttgcctctgaagaaacgccactatcatctcgtgagcaatggcagtgaaaatcaa
gcaaccgaattgggagagcaggaagaaaccccagcggagccgcaggatcaaagcaaagct
aaggctgaaaagaaagaaaaaggcaaagaaaaggactgcaaagggctttccaagtgcgcc
aacgccctgaagaaccacaccaacaacaaccaatacgaagtcaaggttgaaaaggaggcg
agcagccacatagaagaagcgatagaagcgtgcatccacaaattctccgaagaaaaagtt
cccaagccggacgacactgagaacaaatcggtaatggcaaccacccccaaaaagcgccac
agattggagaacttccaagaactctcctcttcattgccggagatcaaaaccgaagtctca
tgttccggtaatgaggacacattggaaaagctcaagtcttcagtcacggtagagtcatac
atcaatgagttgaaaatcaagaggaacttgatggcgcaacttccagaagacaacaacgcg
gcacagcccgaacatggagaggagccaaaaatcaaaaaagaggcatcagcaactgtgcaa
gtggagaaaacggtgccagtctcaccagagagtacaaagaagaaggtgcgcaaaagaagg
gcgtacaaccgaaccgggtttccaaccatcaagaggaagaagaagaagcccatttcgact
tcgaatcttcaggcgaccgtcgtcgatattgacgacatgccaatttgtgatagagtgcct
aaagaaggagaagaaatcacaaagtttcttcaacgcagtagtagagccaatagttccacg
ccagacttagtacgggctaatctcgaggttctagatgaagtgagtgaatgtgagagcctt
cctcaagatgagcgaatcgactgcgacgaggacggcgacagtagtcggtgcgaaagtgtt
gtcgataatctatcggactcgcgaaacaagtcagacattgcagacagtgaaacgctgtcg
cttttggaattctccatcgagcggttaaagtcgcgattacatcagaagacccgaaaacgc
aatcgagacaccagacctttagctgaaaaagccaatatttatcccaagcggcgaaagcga
gaatgttctccagcgagtagcgttgagccgttgctggaaaacaggcttagagacagcgcc
agcgcttctggcgatgaactatcgaagaaaagcaagaaagctcccaagtggaaaaagaag
tatttacctgcaggccttttttccgacttcttcaaagaggaagagtcgaagcgccaggat
gccgcaaaatcatccaggattttggcctacaacgccgaagaccatccgttcggtcttttg
cctcctccttaccattgcggaagatcgttgaggcgtaaaatggtcgactttcagttgcca
ttcgacttatggtggcagcacactcactcgcaattgcccggtagggacttagtgccttcc
tggaactacaggaaaatccgtacaaacgtctataatgtgaaaaccaacggtggttcttgc
gagcctcaatcctgcaattgcaagtctacttcggattgcgacgatgattgcatcaatcga
ctggtgttggccgagtgtcccacgtcgcatcgctgcaacaatcagcgaatccagaagcac
gactgggccccaggcatcgagaaattcatgactgaagacaagggttggggtgtgcgcacc
aaagagccaatcaatcaaggggacttcatcctcgaatacgttggcgaagtggtttcagat
caggaattcaaggaacggatgaatagcatttacgtgaacgatacccaccattactgcctc
catttggacagtgggttggtcattgatgggcatcgaatgggcggagatgggcgatttgtt
aatcattcatgcgagccgaactgcgagatgcaaaagtggagtgtaaacgggcaattcagg
atggcactgtttgcattgcggaacattcagcctttcgaagaattgtcctacgactacaac
ttttcgctgtttaatcctgccgaaggccagccttgcaagtgtcgcagcgcccagtgcaga
ggagtaatcggcgggaaaacgcagaggattaagcaactgcccgaatcaacggtgcctaaa
aacccaggtcgagtgggccgcccgcgcaagaccgaggcaaaaaagaaacccaactcccaa
aaagataacagcgcaaccagcaccactgttccccccataactcaagtggtacctcagatc
caagttaagccgatgagccatcagcagaagtgcttcatcttggaacatcactgcttcctg
ctacggaatttaacaaaagtccgcaaagtaagagatcggtctttgagtgtgacttcaaat
accatcgcaaggcttcatacagccacaccgaccgatacaagcacgttcatcaaccaattg
aacgccattcagaaaccgcggaacatgaagactcgaaaagtggcacaggctgaagacgat
ccggaattgaacaagacaattaaattggccacggttctgaaaaacatcctatcgggtctg
gctgacctgaagggcgataaagacgagagcttgagcagccacttgtatcagcttccgtcc
aagaggaaacttccagagttcttccagaaggtgcaagaccccattgatctgtccactata
gaacaaaaagtggctactggggtttacaagacacccgaagctttcgatatggatatgatc
aagttgttttctggattcgccaaattctatggccgcaacagcgatgtgggaattgcagtc
gccaagctaaagaaactgtatatggcgaccaaacaaaacaatctaccgaagctggagggc
gttttaggcaacaaacctccaccggcctttgctaactgcaagaaaaccaatcacgaagaa
gacatcattcggtgcatttgcggaattccgcgggacgaaggtttgatgatccaatgcgaa
cggtgcatggtgtggcagcacatcgagtgtgtaaaagcagacgcgtctgtggctagctat
cattgtgaggtttgcgtgccccggccgatcgattacgagattcctatggacgatttcact
gaacatggtcaccggtattacatgacgttgatgcggggcgatctgcagctaagacaaggc
gacaccgtctatgttctcagagacataccgattccaggctcggatcgcaagcacacctac
gaaactatcggcaaaatcgactattccgaactggacatttttcgggtggaacgtctgtgg
aaggacaaagattcggggaagaggtttgcctacgggcaccactacttaaggccacacgag
acttttcatgaacctacccgaaaattcttttccaacgaagtcatgcgggtgccattatac
gaagctgttccagtcgagctggtgatggagcattgctgggtgatggacattaatacgttc
tgcaaagggcggcccatcggcgcccaagaagagcacgtctacatttgcgagtatcgagtg
gacaagggcgctaaaatgttcagcaaagtagccaaaagcaagttcccaatatgcaccaaa
agcttcgcgttcgagcagtttgagacccgcatgaaaatatccagaacttattgtccgcat
gatgtggacgcgtctttgctgaagaacggcggagttggacgaagaaggttggacaaggat
aaggagaaactgtcttcaaacgagggcgcagcccaagtggctgcagcacagctgcagtct
gctccggttcctattcaaaggagtccagcgcagcagaaggctcgactgaacaaaatccta
ttgaatcttttgagcaaaatgcccactaagcaaatagtggacgtctcttatctgctggaa
ggtggcaggcgaaggaaaaaacaagaaactaagcaatga

DBGET integrated database retrieval system