KEGG   Dendroctonus ponderosae (mountain pine beetle): 109542570Help
Entry
109542570         CDS       T04899                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase-like
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MMADFCPVPNPDVHRDFLQKVVDLLFKNVVFTTRRDKVLLWKTPEELQGEFDFTLPQAGD
SQDKLLQIMKNTVKFSVKTGHPYFINQLFSGLDPYGLAGQWLTDALNASVYTYEVAPVFT
LMEQHVIKEVCKMVGPQWSDGIFCPGGSFGNGTAMNLARFHKFPQAKLKGCNILPRMVVL
ASEECHYSTYKFAAFLGMGEDNVWPLKTDDVGQIVPEKVEEAIQAVLLEGAVPLMVVATL
GTTVRGAFDPIHAIATICKKYEIWLHVDAAWGGGLLFSQKHRAKLNGIEAANSIVINPHK
LLAVPQQCSMLLVTHPDILHRCHSRGAEYLFQKDKYYDASYDLGDRYLQCGRKCDVFKFW
IMWRAKGSCGFAKHIDTLMDLAEYFEQQVNARPDFVLVSKRQYVNVCFWYLPRYLRGKLN
ISDYNAQLQKVAPQIKAVMVKHGSVMLNYQPLKTLPNFFRFVSQNSALTKKDADFILDHI
AEIGDALFP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgatttttgcccggtgccgaatccagacgttcatagggactttttgcagaaa
gtcgtcgatttgctgtttaaaaatgtcgtgtttaccaccaggcgggacaaagtgctgctg
tggaaaactccagaggagcttcaaggggaatttgactttacgctaccgcaagcgggcgat
agtcaggataaattgctgcagatcatgaaaaacactgttaaattcagcgtgaagactgga
catccatattttatcaaccagctgttctctgggctggatccctatggattggcaggccaa
tggctgaccgacgctttgaatgcgagcgtttacacttacgaagtggctcccgtattcact
ttgatggaacagcacgtaatcaaggaggtctgcaagatggtgggacctcagtggagtgac
ggcattttctgtcccggaggctcattcggcaatgggacggctatgaatctggcccgattt
cacaagtttccccaagccaaactcaaaggctgcaatattctacccagaatggtggtgctg
gcctcagaagaatgccactattccacctataagtttgcggcctttttgggcatgggcgag
gacaatgtgtggccactgaaaacagacgatgttggacagattgtgccagagaaagtggaa
gaagccatccaggcagttctgctggaaggggcggtgcccttgatggtggtggctacttta
ggtacaacagtgcgaggtgctttcgatccgattcacgctattgccaccatatgcaagaag
tatgagatctggctgcacgtggacgctgcttggggtggaggactgttattttcacaaaaa
cacagagcgaaattgaatggaatagaggcagccaactcaatagtcatcaatcctcataag
ttgctggccgtgccccaacaatgttcgatgttgctcgtgacccatccggacatcctgcat
cgatgtcattcaagaggggccgaatatctattccagaaagataaatattatgacgccagc
tatgacttaggcgatagatatctgcagtgcggccgaaaatgtgatgtcttcaagttctgg
atcatgtggagggccaagggttcatgcggatttgccaagcacattgacacgctgatggat
ctggcggaatatttcgagcagcaagttaacgccaggccggatttcgtgctagtctcaaag
cgtcaatacgtgaatgtttgcttttggtatttgcccagatatttgcgggggaaactcaat
atttccgactacaacgcccaactacaaaaggttgcaccccaaatcaaagccgtaatggtg
aagcatggctcagtaatgctgaactaccaaccgctgaaaacgctgcccaatttcttcaga
tttgtgtcgcaaaattcggcgctcactaaaaaggatgccgatttcattttggatcatatt
gctgaaattggcgacgctctttttccgtag

DBGET integrated database retrieval system