KEGG   Deinococcus peraridilitoris: Deipe_0633Help
Entry
Deipe_0633        CDS       T02381                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipe_0633
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_0633
   00620 Pyruvate metabolism
    Deipe_0633
   00630 Glyoxylate and dicarboxylate metabolism
    Deipe_0633
  Energy metabolism
   00680 Methane metabolism
    Deipe_0633
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deipe_0633
Enzymes [BR:dpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Deipe_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(640674..641669)
Genome map
AA seq 331 aa AA seqDB search
MTQHMKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEITPALGALRGVVME
LEDCAFPLLAGVVQTDDPNVAFKDAEYALLVGSRPRTKGMERKDLLEANGAIFTVQGKAL
SDVASRNVKVLVVGNPANTNALIAMRSAPNLDPRQFTAMVRLDHNRALSQLASKTGKSVT
TMRHMTIWGNHSVTQYPDLYHAEVDGQNAYELVNDHAWYEQEYIPTVAKRGAAIIEARGA
SSAASAASAAIDHMRDWALGTPEGDWVSMAVPSDGSYGIPEGVIYGFPCTCSGGDYQIVQ
GLDVNEFSRRKMDETYQELAEERDAVQHLFS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcacatgaaacaacctgttcgcgtggccgtcacgggagcggccggccagatc
ggctacagcctgctcttccgcatcgcctcgggcgagatgctcggcaaagaccagccggtc
attctgcagctcctcgaaatcaccccggcgctgggcgcgctcaggggcgtcgtgatggaa
ctcgaagactgcgcctttccgctgctcgcgggcgtggtgcagaccgacgacccgaacgtg
gccttcaaggacgccgagtatgccctgctggtcggcagccgtccacgcaccaagggcatg
gagcgcaaggacctgctcgaagccaacggcgcgatttttacggtgcagggcaaggccctc
agtgatgtcgcgagccgcaacgtgaaggtgctggtcgtcgggaaccccgccaacaccaac
gccctgatcgccatgcgcagcgcacccaacctcgatccccggcagttcaccgccatggtg
cgcctcgaccacaaccgcgcgctctcgcagctcgcaagcaagaccggcaagagcgtcacc
accatgcgccacatgaccatctggggcaaccactcggtcacccagtaccccgacctctac
catgccgaggtggacggccagaatgcctacgagctggtaaacgatcatgcctggtacgag
caggaatacattcccaccgtcgccaagcgcggcgcggcgatcatcgaggcgcgcggtgcg
tcgagcgccgccagtgcggcgagcgccgcgatcgaccacatgcgcgactgggccctgggc
actccggaaggcgactgggtcagcatggctgtgccgagcgacggcagctacggcattcct
gaaggggtcatctacggctttccctgcacctgcagtggcggcgactaccagatcgtccag
ggcctcgacgtgaacgagttcagccgccgcaagatggacgaaacctaccaggagctggcc
gaagagcgcgacgccgttcagcacctgttttcgtaa

DBGET integrated database retrieval system