KEGG   Drosophila persimilis: Dper_GL10903Help
Entry
Dper_GL10903      CDS       T01063                                 

Definition
(RefSeq) GL10903 gene product from transcript GL10903-RA
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpe  Drosophila persimilis
Brite
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dper_GL10903
Peptidases [BR:dpe01002]
 Metallo Peptidases
  Family M2
   Dper_GL10903
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL10903
CD molecules [BR:dpe04090]
 Proteins
  Dper_GL10903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6590076
NCBI-ProteinID: XP_002015666
FlyBase: FBgn0148513
UniProt: B4GD18
LinkDB All DBs
AA seq 642 aa AA seqDB search
MNLGLSPKYLRLILVMVMALIPTLVDCSINKANSNHSANYEASTREILDIATGRMQTIWN
MKQRIFLQLTSKGKSPLGGQAPSKQEVEMETYHLMYELAANLSVVPVKELEDPLLRRRVQ
RLSKLQLQGLRPRNYEQAKDLLRAMRNFVSGPLVCTFEECTTRRPLAMYPHIVNKNMRAK
HYEDLVLNWFSWRRAINDKDTAKSTFIDYVRLLRIAATYNGHVTPSRTWYLHYDTENFQA
EMEAVVWEIMPLYRELHAYLRHEVQVTYPKADTKSDGAIVAPVMDQILSQDWYPHQFFRT
PHPSRQHQLPSVHRRLEEVLVTPVKINKKAAEFFESLGLNHISDGFYDRYSRRMNDDEGG
PDCKSQVYYFPPDVALRYCPKLDYKKMMQIHGTMAELQYNIYKRNLPFGLDTEPCPGFGS
ALAETVVLASGTARHLHRLHILLNESLTEEQSLNRLFRMGVHTLVAVPQYFINDKFLVDV
MDGRIGVKEYNCAYWRLQDKFAGVQPPALHSSKDFDPDFKFYRGMNPETSNTKKFLSEIL
GFQFYRSFCLVSGQYKPGDAKFPLHNCDFYDSKEAGDMMREMMQLGASRHWRDVMEIATG
ERKLSGRGILEYFAPLFTWLKERNKQLDIEPGWDADDLCRKE
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggggctctccccgaagtaccttcgactgatcctggtcatggtaatggccctg
atcccgaccttggtggactgtagcatcaataaagccaattccaatcactcggccaactat
gaggcgtccacacgggaaatcctggacatagccacagggcggatgcaaaccatttggaac
atgaagcagaggattttcctccagctgacatctaagggaaagtcgccgctgggcggacag
gcgcccagcaagcaggaggtcgaaatggagacctaccacctgatgtacgagctggcggcg
aatctgagcgtagtgcccgtgaaagagttagaggatccgctgctgcgacgtcgcgtccag
cgcctgtccaagctgcagttgcagggactgcggccgcggaactacgagcaggccaaggat
ctgctgcgggccatgaggaactttgtgagtggtccgttggtctgcaccttcgaggagtgc
accacgcgtcgccccctggccatgtatccgcacatcgtcaacaagaacatgcgggccaag
cactacgaggacctggtccttaactggttcagctggcgacgggccatcaacgacaaggac
acagccaagtccacgttcatcgactacgtgcggctgctcaggattgcggctacctacaat
ggacatgtaacgccgtcgaggacgtggtacctccactacgacacggagaacttccaggcc
gagatggaggcggtagtgtgggagatcatgccgctctaccgcgaacttcacgcctatcta
cggcacgaggtgcaggtaacctacccgaaggcggacaccaagagcgacggcgctattgtg
gcaccggttatggatcagatcctgtcccaggactggtatccgcaccagttcttccgcact
cctcacccaagcaggcagcaccagctgccgtctgtccatcgtcgtctcgaagaagtccta
gtcactcccgtgaagatcaacaagaaagctgccgagttcttcgagtcgctgggcctcaat
cacatttccgatgggttctacgaccgctactcccggcggatgaacgatgacgagggcggg
ccggactgcaagtctcaggtctactacttcccaccggatgtggccctgcgctactgcccc
aagttggactataagaagatgatgcagatccatggaacgatggccgagttgcagtacaat
atttacaagcggaatctgccctttggcctggacaccgagccttgtccgggcttcggcagt
gccttggccgagactgtggttctggcctcgggcacggcccggcacttgcatcggctgcac
atcttgctgaacgagagcctcacggaggagcagtccctcaatcggctgttccgcatgggg
gtgcacaccctcgtggctgtgccgcagtacttcatcaacgacaagttcctggtggacgtg
atggatggacggatcggggtgaaggagtacaactgcgcctattggcgtcttcaggacaag
ttcgccggcgtccagcctcctgccctgcattcatcgaaggattttgatccggattttaag
ttctatcggggcatgaacccggaaacatccaacaccaagaaatttctgtcggaaatattg
ggattccagttctatcgctccttctgcctggtcagtggccagtataagcccggagatgca
aagtttcctttgcacaactgcgatttctacgacagtaaggaggcgggcgatatgatgcgg
gaaatgatgcagctgggggcctcccggcattggcgggatgtcatggaaattgccactggg
gagcgaaagttgagtggtcgtggtattctcgagtactttgccccgctcttcacttggctg
aaggaacgcaacaagcagctggacattgagcccggctgggatgccgacgatctatgccga
aaggagtaa

DBGET integrated database retrieval system