KEGG   Drosophila persimilis: Dper_GL11797Help
Entry
Dper_GL11797      CDS       T01063                                 

Definition
(RefSeq) GL11797 gene product from transcript GL11797-RA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dpe  Drosophila persimilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dper_GL11797
   04068 FoxO signaling pathway
    Dper_GL11797
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dper_GL11797
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dper_GL11797
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dper_GL11797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 218 aa AA seqDB search
MFTARKLSQAACSISVRGKHSLPKLSYDYAALEPIICREIMELHHQKHHQTYVNNLNAAE
EQLAEASSKNNTSKIIQLAPALRFNGGGHINHSIFWQNLSPKKSTPSDDLKKAIESQWKS
FDEFKKELSALTVAVQGSGWGWLGYNKKSGKLQLAALPNQDPLEASTGLVPLFGIDVWEH
AYYLQYKNVRPSYVEAIWDIANWDDISCRFQEAKKLTT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagctcgcaaactctcccaggcagcgtgcagcatttcagtgcgcggcaagcat
tcgctgcccaagctgtcgtacgactatgccgcattggagcccattatctgccgcgagatc
atggagctgcaccaccagaagcaccaccagacctacgtcaacaacctgaacgcggccgag
gagcagctggcggaagcctcgtccaagaacaacacctcgaagatcattcagctggccccg
gccctgcgcttcaacggcggcgggcacatcaaccacagcatcttctggcagaatctctcg
cccaaaaagtccacacccagcgacgacctcaagaaggctatcgagtcgcagtggaagagc
ttcgacgaattcaagaaggagctcagcgccctcacagttgccgttcagggttctggatgg
ggctggctgggctataacaagaagtcgggcaagctgcagctggctgccttgcccaaccag
gatcctctcgaggccagtaccggcctggtgcccctcttcggcatcgatgtgtgggagcac
gcctactacttgcagtacaagaacgtgcgtccctcgtatgtggaggccatctgggacatc
gccaactgggacgacatctcgtgccgcttccaggaggccaagaagctgactacctag

DBGET integrated database retrieval system