KEGG   Drosophila persimilis: Dper_GL11848Help
Entry
Dper_GL11848      CDS       T01063                                 

Definition
(RefSeq) GL11848 gene product from transcript GL11848-RA
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dpe  Drosophila persimilis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dper_GL11848
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dper_GL11848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 726 aa AA seqDB search
MTSRMFKFGVTATSAAVGSVLAAWTLDHWNTPRVVNNAAVAPPKRKRTLPMRSEQIKSLM
SGEEFDVLIIGGGATGAGCALDSVTRGMKTALVELDDFASGTSSRSTKLIHGGVRYLQKA
ILGLDLEQYRMVKEALQERATMLESAPHLTHPLPIMLPVYTWWQVPYFWVGIKAYDFVAG
DRNVKSSYYLSKKDALELFPMLKKDKLCGAIVYYDGQQDDARMCLAVALTAARHGATVCN
HVEVKELLKKDDGTGKQVLCGAKLKDHISGKEFTVKAKCIVNATGPFTDSIRKMDNPSVK
SICCPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWQRQTIAGTTDLPCEITHNPI
PTEDEIQFILKEIKNYLNADVEVRRGDVLSAWSGIRPLVSDPNKDDTQSLARNHIVHISP
SNLITIAGGKWTTYRAMAEHTIDAAIKACNLKPERAEAVTSYLKIEGGQGWTPTMYIRLV
QDFGLECEVAQHLAKSYGDRAFAVSKMASLTGKRWPIIGNRIHPEFPYIDAEIRYGVREY
ACTAVDMIARRLRLAFLNVQAAQEALPVIVDIMGEELKWSKEEKERQIKVATEFLANEMG
HSVNRTSKERIPIKLSKEEIQTYIKRFQLIDKDKKGYVSINDIRRGLKSFGESDVSGEQL
HEILREIDTNMNGQVELDEYLQMMSAIKTGDVAYSRFARMAELEEQKHEAANLKQKISVD
RSGGGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgcggatgttcaagttcggcgtgaccgccaccagtgcagccgtgggatccgtt
ctggccgcctggaccctcgaccactggaacaccccccgtgtggtgaacaatgctgcggtg
gcaccgccgaagagaaagcgcacactgcccatgcgatctgagcagatcaagtctctgatg
agcggcgaggagttcgacgtgctaatcattggcggcggagccactggagctgggtgtgcc
ctcgactcggtgacacgaggtatgaagacggctttggtggagctggacgatttcgccagc
ggcacctcatcgcgctccaccaagctcatccacggcggagtgcgatacctgcagaaggct
attttgggcctagaccttgagcagtaccgaatggtgaaggaggcgctgcaggagcgcgcc
accatgctcgaatcggcgccccatttgacccatccgctgcccattatgctgcccgtttat
acgtggtggcaggtgccgtacttctgggtgggcatcaaggcctacgattttgtggcgggt
gaccgcaacgtgaagagctcctactatctgtccaagaaggacgctctggagctgttcccc
atgctcaagaaggacaagctgtgcggcgctatcgtttactacgacggacagcaggacgac
gcccgcatgtgcctggccgtggcactgacggcagcccgccacggtgccaccgtctgcaat
cacgtggaggtaaaggagttgcttaagaaggacgacggcaccggcaagcaggtgctgtgc
ggcgccaagctcaaggaccacatctccggcaaggagttcaccgtgaaggccaagtgcatc
gtgaacgctaccggccccttcacggactccatccgcaagatggacaacccctcggtgaag
agcatctgctgccccagctccggcgtgcacatcgtgctccccggctactacagccccgac
cagatgggcctgctcgatccctcgacgtccgatggacgcgtcatcttcttcctgccctgg
cagcggcagacgatcgccggcaccaccgatctgccctgcgagatcacccacaaccctata
cccaccgaggacgagatccagttcatcctgaaggagatcaaaaactacctgaacgcggac
gtggaggtgcgccgcggcgacgtcctgtccgcctggagtggcatccgacccctggtctct
gaccccaacaaggacgacactcagtccctcgcccgtaaccacatcgtccacataagcccc
tccaatcttatcaccattgccggcggcaagtggaccacctatcgcgccatggccgagcat
accatcgatgcggctatcaaggcctgcaatctaaagccggagcgggcggaggccgtcacc
tcctacctgaagatcgagggcggtcagggctggacaccgaccatgtacatccgcctggtg
caggacttcgggctggagtgcgaggtggcacagcacctagccaagtcgtacggcgaccgc
gcctttgccgtctccaagatggcctcactgacgggcaagcggtggcccattatcggcaac
cgcattcaccccgagttcccctatatcgacgccgagatccgttatggcgtgcgcgaatat
gcctgcacggccgtggatatgatcgcccgccgtctgcgattggccttcctcaacgtgcag
gcggcgcaggaggcgcttcctgtgattgtggacataatgggcgaggagttgaagtggtcc
aaggaggagaaggagcgccagatcaaggtcgccaccgagttcttggccaacgagatgggc
cactcggtgaaccgcacctccaaggagcgcatacccattaagctttccaaggaggagatc
cagacctacatcaagcgcttccagctgatcgacaaggacaagaagggctatgtctccatc
aatgatatccgccgcggcctcaagagcttcggcgaaagcgacgtttccggcgagcagctg
catgagatcctccgcgagatcgataccaacatgaacggccaggttgagctcgacgagtat
ctacagatgatgtccgcgatcaagacgggcgatgtggcctactcccggtttgcccgtatg
gccgagctggaggaacagaagcacgaggctgccaatctcaagcagaagatcagcgtggac
cgctctggcggcggcttgtaa

DBGET integrated database retrieval system