KEGG   Drosophila persimilis: Dper_GL12073Help
Entry
Dper_GL12073      CDS       T01063                                 

Definition
(RefSeq) GL12073 gene product from transcript GL12073-RA
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL12073
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dper_GL12073
Chromosome [BR:dpe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dper_GL12073
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dper_GL12073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 1004 aa AA seqDB search
MATAEAQVNVNRNLQKQDLRNLEVSNLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIKLLLKSKHQRHKYDIQQQKLLRILAERRKARA
MTPLAPASVLAPSMETARPRLRSTSLNSLSPSNSSGYGSILGCDDSDQSSQLVLKPNVLK
RRRSNCVQIPTPAAKRSRKNDGTTVKRRPKGEYIVEKIESVEVVQFQPVFFVKWLGYDVS
ANTWESYVNLSDCAEMEKFVERHLQLHQHYIAQLTGELDTQLSDIPQTEDLKTISIAEID
AYDPLELQIDIILLAQYRAAASRSQREPERIGARALHRMQVRRSHFARRKQLIDLLLFEH
RMNRVELPSPPIRVENNWDLDTIDSGFKYIQKNIIGAGVPKPQAGLVGCMCRHQSGEQCT
ASSMCCGRMAGEIFAYDRTTGRLRLRPGSAIYECNSRCSCDESCTNRVVQNGRKHPLVLF
KTSNGSGWGVRTPQPLKKGVFVCEYIGEIITCEEANERGKAYDDNGRTYLFDLDYNTSRD
SEYTVDAANFGNISHFINHSCDPNLAVFPCWIEHLNTALPHLVFFTIRPIKAGEELSFDY
IRADNEEVPYENLSTAARVQCYANAKIYKCDNPKCPRPASFVSDASSKDDSLPCTRPACS
GNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMK
LKQILILQNKIDLIKESQAKEQYEEITKFVQGTVAEGAPIIPISAQLKYNIDVLCEYIVN
KIPVPQRDFNAPPRLIVIRSFDVNKPGCEVQDLKGGVAGGSILSGVLKVGQEIEVRPGVV
TKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGTKIDPTLCRADRLVGQVLGAV
GQLPDIYQELEISYYLLRRLLGVRTDGDKKGARVEKLQKNEILLVNIGSLSTGGRISATK
GDLAKIVLTTPVCTEKGEKIALSRRVENHWREVLHRPASPVQSY
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagctcaagtcaatgtgaatcggaatttgcaaaagcaggaccttagg
aatttggaagtcagcaaccttacacctctgtcgcccgaggtgatctcgcgccaggcgacc
atcaacatcggcacaatcggacatgtagcacacggaaagtccaccgtagtcaaagccata
tccggcgtgcagacggtccgctttaaaaacgaattggagcgcaacattacaattaagctc
gaacgcttaagcgaaaagaaaatcaagctacttttgaaatccaaacaccagcgacacaaa
tacgatatccagcagcaaaagctgctacggattctcgccgagcggcgaaaggccagggca
atgacaccccttgcccccgcttcagtgctagccccatccatggaaacagctcgtccgcgt
cttcgcagcaccagcctaaactcattaagtcccagcaacagcagcggctatggcagcatc
ctcggctgcgatgatagcgatcaatcatcacagctggtcctgaaaccgaacgttcttaag
cgacgacgtagcaactgtgtccagatacccactccagcagccaaaaggagcaggaaaaac
gatggaacgactgtgaagaggcgacccaagggcgagtacattgtggagaaaatcgagagc
gtcgaggtggtccagtttcagcccgttttctttgtgaaatggctgggatacgatgtcagc
gcgaacacatgggaatcgtacgtaaatctatctgattgtgccgaaatggaaaaatttgtt
gagcgtcatctacagctgcatcagcattatatagcccagctcacgggggaactggatacg
cagttgtcggacataccgcagacggaagatcttaagactattagcattgcagagattgat
gcctatgatccgctcgagttgcagattgatattatactgctagcgcaataccgtgccgct
gccagccgcagccagcgggaacccgagcgaatcggtgcgcgggccctgcaccgcatgcag
gtcaggcggtctcactttgcacggcgcaagcagctgattgatttattgctgtttgaacac
cgaatgaatcgagtcgagctgccgtcgccgcccatacgagtggagaacaattgggatctg
gacacgattgacagcggcttcaagtacatacaaaagaacataattggagcaggggtaccc
aagccgcaggctggacttgtgggttgtatgtgccgccaccagagcggagaacaatgcacc
gcctcctccatgtgttgtggaagaatggctggtgaaatctttgcctacgatcgtaccacg
ggacgtttgcggctccggccgggcagtgccatctatgagtgcaacagtcgatgctcctgc
gacgagagttgcacgaatcgtgtggtacagaatggacgaaagcatccgcttgtgctcttt
aaaaccagcaatggcagtggttggggtgtccgcacaccgcagccattgaagaagggagtg
tttgtctgcgaatatatcggcgagatcattacgtgcgaggaggctaatgagcgtggcaag
gcctatgacgataatgggcgtacctatctgtttgatctggactacaatacatcgcgggat
agcgagtatacggtggacgcggccaactttggcaatatatcgcattttatcaatcattcg
tgtgatcccaatctggccgtgttcccatgctggatcgagcacttaaatacggccctgcca
catctggtcttctttaccattcgcccgattaaggcgggggaggagctcagctttgactac
attcgggcggacaacgaggaggtgccatatgagaatctatcgacggctgcgcgtgtccag
tgttatgccaatgccaaaatctacaagtgcgacaatcccaagtgcccgcgcccggccagc
tttgtttcggatgcctcgagcaaggatgacagcttgccctgcacgcgacccgcctgctct
ggcaatttcagactggtgcggcatgtgagctttgtggattgccccggtcacgacattctt
atggccaccatgttgaacggtgccgctgtaatggatgccgcactgctgctcattgctggc
aatgaatcctgccctcaaccgcaaacctctgagcatttggctgccattgagatcatgaaa
ctgaaacagatcttgatattgcaaaacaaaatcgatctgatcaaggagagccaggcgaag
gagcagtacgaggagatcaccaagtttgtccagggcaccgttgccgagggcgcgccgatt
atacccatttcggcccagctcaaatacaacattgatgtgctctgtgaatatattgtgaac
aagattcctgtaccgcagcgggactttaatgcgccgccccgtctgattgtcatccgctcc
ttcgatgtgaacaagccgggctgtgaggtgcaggacctgaagggcggcgtcgccggtggc
tccattctgagcggtgtgctgaaggtgggccaggagatcgaagtgcgtcccggtgtcgtg
accaaggacagcgatggcaacattacctgccgccccatattctcgcggatcgtttcactg
tttgccgaacagaacgaactgcagtatgccgttcctggtggcctgatcggtgtgggcacc
aaaatcgatcccacgctctgtcgtgccgatcgtttggtgggccaggtgctgggtgccgtc
ggacagctgccggacatctatcaggagctggaaatttcatactacctgttgcgtcgcctg
ctcggcgtacgtacggatggcgacaagaagggtgcgcgtgtcgagaagctgcagaagaac
gagatcctgctggtcaacattggatcgctcagcactggcggccgcatctcggccaccaag
ggtgatttggccaagattgtgctcacaactccggtgtgtaccgagaagggcgagaagatt
gccctcagcagacgtgtggagaaccattggcgggaagtactacacaggccagcatcaccc
gtccaatcatactaa

DBGET integrated database retrieval system