KEGG   Drosophila persimilis: Dper_GL15565Help
Entry
Dper_GL15565      CDS       T01063                                 

Definition
(RefSeq) GL15565 gene product from transcript GL15565-RA
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dpe  Drosophila persimilis
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dper_GL15565
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dper_GL15565
   00982 Drug metabolism - cytochrome P450
    Dper_GL15565
   00983 Drug metabolism - other enzymes
    Dper_GL15565
Enzymes [BR:dpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dper_GL15565
Transporters [BR:dpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dper_GL15565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 253 aa AA seqDB search
MSDTEHLTTGSTKPIFPDDGVLRLYSMRFCPYAHRVHLVLDAKNIPHHNIYINLQAKPDW
FTKMSSTAKVPALEVVKEGENSVLIESLVICDYLDEMYPEVPLYPTDPLKKAQDKILIQR
FGHFITSLYKMLLDDKRELDLTDLITDLEIYENELKKRGSKFFGGSKPGMLDYMIWPWCE
RFAALKLDDGTQAELDPQRFLTLLQWRDLMLQDKAVKIFYLDGETHDKYMNSRKAGSADY
NMLYHAAKRTRRE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacactgaacatcttactactggctccaccaagcccatctttccagacgatggt
gtgctgcgcttgtactcgatgcgtttttgtccctatgcacaccgcgtgcacctcgttctt
gatgcaaagaacataccgcatcacaacatctatattaatctgcaagctaaacccgactgg
tttaccaagatgagcagcaccgccaaggtgccggcactggaagtcgtcaaggaaggcgag
aattctgtgctaattgaatctctagtcatttgcgattacttggatgagatgtatccggaa
gtaccgctctacccaacagacccgttgaagaaggcccaggacaagatactcattcagcgt
tttgggcatttcattacatccctttacaagatgttgctagacgacaagcgcgaactggac
ctgaccgacttgatcaccgacttggaaatttacgagaatgagctaaagaagcgaggaagc
aaattctttggcggctccaagccgggaatgctagactacatgatttggccttggtgcgag
cgctttgctgctctgaaacttgacgacggcactcaagctgagttggatccacagcgcttt
ttgacactactccaatggcgcgacttgatgctccaggataaggccgtgaaaattttctat
ctggatggggagactcatgacaaatatatgaactcccgtaaagctggcagtgcagattac
aacatgctctaccatgccgccaagcgtacaagacgggagtaa

DBGET integrated database retrieval system