KEGG   Drosophila persimilis: Dper_GL17143Help
Entry
Dper_GL17143      CDS       T01063                                 

Definition
(RefSeq) GL17143 gene product from transcript GL17143-RA
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dpe  Drosophila persimilis
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dper_GL17143
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dper_GL17143
Peptidases [BR:dpe01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dper_GL17143
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dper_GL17143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 256 aa AA seqDB search
MLKFVILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSV
YSASIVVTAAHCLQSVSASTLQVRAGSTYWSSGGTVVKVASFKNHEGYNANTMVNDIAVI
RLSSALGLSSTIKAIGLASSAPANGAAASVSGWGTLSYGSSSIPTTLQYVNVNIVSQSQC
ASSTYGYGSEIKSTMICAYSSGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYANYPGVYA
DVAALRSWVVSAASSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcgtgatcttgttgtctgctgtcgcctgcgccctgggaggcaccatccca
gagggtctcctgccccagctggatggccgcattgttggaggcaccgccaccaccattagc
agcttcccctggcagatctccctgcagcgcagtggctcccactcctgcggtggctcggtc
tactccgccagcatcgttgtgaccgctgctcactgcctgcagtccgtgtccgcctcgacc
ctccaggtccgtgcaggttccacctactggagctccggcggcaccgtcgtcaaggttgca
tccttcaagaaccacgagggctacaacgccaacaccatggtcaacgacatcgctgtcatc
aggctgagctctgccctgggcctcagctccaccatcaaggctatcggtctggccagttct
gctcccgctaacggtgctgctgcttccgtctccggatggggtaccctgtcgtacggctcc
agctccatccccaccaccctgcagtacgtgaacgtgaacatcgtcagccagtcgcagtgc
gcttcctccacctacggttatggcagtgagatcaagtccaccatgatctgcgcttattcc
agcggcaaggatgcctgccagggtgattccggcggcccattggtctccggcggtgtcctc
gttggtgttgtgtcctggggctatggctgcgcctacgccaactaccccggtgtctacgcc
gatgttgctgctctccgctcctgggtggtcagcgccgccagctcggtctaa

DBGET integrated database retrieval system