KEGG   Drosophila persimilis: Dper_GL21847Help
Entry
Dper_GL21847      CDS       T01063                                 

Definition
(RefSeq) GL21847 gene product from transcript GL21847-RA
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dpe  Drosophila persimilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dper_GL21847
   00051 Fructose and mannose metabolism
    Dper_GL21847
   00052 Galactose metabolism
    Dper_GL21847
   00500 Starch and sucrose metabolism
    Dper_GL21847
   00520 Amino sugar and nucleotide sugar metabolism
    Dper_GL21847
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dper_GL21847
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dper_GL21847
Membrane trafficking [BR:dpe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dper_GL21847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 456 aa AA seqDB search
MSVVPTTIAPEVEAAVAGFMLTQAQMTEVVERMTKEIKMGLARDTHPRAVIKCFVSYVQD
LPTGKERGKYLALDLGGSNFRVLLVDLKSNTDIDIVSKSFVIASSMLSGPGKDLFDFIAN
CLADFCKEQRLQGEAIPLGFTFSFPLQQQGLTKGILVTWTKGFSCEGVVGKNVVALLQEA
IERRGDLKINIVAILNDTVGTLMSCAFTSRNCRIGLIVGTGSNACYVEKTVNAECFENYQ
TSPKPHMIINAEWGAFGDNGVLDFVRTPYDRIVDKVTPNPGKQTFEKCISGMYMGELVRL
VLVDLMAKGLIFAGERSEKIQTQWNFQTSYLSDIESDSPGDFRNCSKVISQLGLVGNHVR
DKLHLRYICEAVSSRSAKLCSCGLVTLINKMNINDVSVGIDGSVYRFHPRYHDLLMFHMT
KLLRPGIKFELLESDDGSGKGAALIAATAVQNQVSK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggtacccacaaccattgccccagaggtggaggccgcggtggcgggcttcatg
ctgacccaggcccagatgaccgaggtggtcgaacgcatgaccaaggagatcaagatgggc
ctggccagggacacccatccgcgggcggtcatcaagtgcttcgtcagctacgtgcaagac
ctgcctacgggaaaggagcgcggcaagtacctggctctcgatctgggcggctccaacttc
cgtgtgctcctggtcgacctgaagagtaacacggatatcgacattgtctcgaagagcttt
gtaattgcaagtagcatgctatcgggccccggcaaggatctgttcgacttcattgccaac
tgcctggccgatttctgcaaggagcaacgcctccagggggaagccattcccctaggcttc
accttctcgttccccctgcagcaacagggcctgaccaagggcatcctggtcacctggacc
aagggctttagctgtgagggagttgtgggcaagaatgtggttgccctgcttcaagaggcc
attgagcggcgtggtgacctcaagatcaacatagtagctatcctcaacgacaccgtcggc
accctcatgtcctgtgccttcacgtcacgcaactgccgcataggcctcatcgtcggcacc
ggctccaatgcctgctacgttgaaaagacagtgaatgcggaatgcttcgagaactaccag
accagtcccaagccgcacatgatcatcaacgctgagtggggagccttcggggacaacggc
gtgctggattttgtccgcaccccctacgaccgcattgtggacaaggtgacgcccaatccc
ggcaagcagaccttcgagaagtgcatctctggcatgtacatgggcgagctggtgcgtctg
gtactggtggacctcatggctaaggggctgatctttgccggcgaaaggtctgagaaaatt
cagacgcaatggaatttccaaaccagctacctctcagacattgagagcgatagcccgggc
gactttcgtaactgcagcaaggtcatcagtcagctgggactcgtcggcaaccacgtgagg
gacaagctacatttgcggtacatctgcgaggcggtctcttcgcgctcagcaaagctctgc
tcctgcggcctggtcacccttatcaataagatgaacatcaacgacgtgtccgtgggcatt
gatgggagtgtgtatcgctttcatccccggtatcacgatttgttgatgttccacatgacc
aagttgttgaggcctggcatcaaatttgagctcctggagtccgacgacgggtcaggcaag
ggtgcggccttgattgcagccaccgctgtgcagaaccaagtctccaagtag

DBGET integrated database retrieval system