KEGG   Danaus plexippus (monarch butterfly): KGM_210982Help
Entry
KGM_210982        CDS       T04344                                 

Definition
(GenBank) serine protease like protein
Organism
dpl  Danaus plexippus (monarch butterfly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MLGSKLHCGGAIITDQHVLSAGHCITFGVNFKDLTVYIGMHDRLGSTHTVSRLKNGVKHP
SFTSNAVRDINDIAILTLDKKLQFSDKVRPICLPSEGMDFKNVPLTVAGWGKTRQGALTS
SRYLLETKVKIVPSNTCSKSSIYKDNLVTDSMMCAYSLGKDACQGDSGGPIFATHARTHN
KKWYQVGIVSWGIDCAMPDYPECGTPSDKIISMRIVGGRRAEPHSFPWTVAIVKNDRMHC
GGAIITDRHVLSAGHCFKWDDRKQMKVYIGLDDLEDMNNVEVRNISNVVIHEQFTSTAVR
DENDIAIATLNKPVTFSDTIVPICLPSPGQKFDGRSGTIVGWGRLGTDKTSSKVLMKASL
RILSDEECFKSKLASHIKPMMMCAFTKGKDGCQGDSGGPLLTFESDGRYVQAGIVSWGIG
CANPNYPGVYTKVSNYNDWIEKNTANGKTCD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatcgaaactacattgtggaggtgcaattattaccgaccaacacgttttaagt
gctgggcactgtatcacttttggtgttaattttaaagatctaaccgtctacataggaatg
catgatcgtttggggagcactcataccgtctctagactgaagaatggtgttaagcatccc
agcttcacttcaaatgccgttcgagacatcaatgacattgcgattttaacactcgacaaa
aagcttcaattttcagataaagttcgtccaatatgcttaccaagtgaaggaatggatttt
aaaaatgtaccactaactgtagccggatggggaaaaactagacaaggagctctaacatca
tcgagatatttattagaaactaaggttaaaattgttcctagtaatacgtgttccaagtcg
tctatatacaaagataatcttgtcaccgattccatgatgtgtgcttatagtcttggaaaa
gacgcttgtcagggtgatagcgggggaccaattttcgctacacatgcacgaacacataac
aagaaatggtaccaagttggtatcgtctcttggggtatagattgcgctatgccggactat
cctgaatgcggaacaccatcagacaaaataatatcaatgagaatagtgggtggtagaaga
gctgagcctcactcgtttccttggactgtggctatcgtgaagaatgatcgaatgcattgc
ggtggtgccataataacagaccggcatgtcctcagcgctggtcattgttttaaatgggat
gatagaaagcaaatgaaagtttatataggtctcgacgatttggaagacatgaataatgtt
gaagttaggaacatctcaaatgtggtcattcacgaacagttcacatcgaccgctgttcga
gacgaaaatgatatagcaatcgctactttaaacaaaccagttacgttcagtgacacaatc
gtaccaatatgtttgccttctccgggacaaaaatttgatggtagatcaggtactatagta
ggatggggtcgtcttggaactgataaaacatcttcgaaggttctaatgaaagccagtctt
cgaattctcagtgacgaggaatgttttaaatccaaattggccagccatataaagccaatg
atgatgtgtgctttcactaaaggaaaagacggttgtcagggcgacagtggtggaccactt
ttgacgtttgaatccgacggaagatacgttcaagcaggaattgtgtcgtggggtattgga
tgtgcaaacccaaattacccaggtgtgtacactaaagtgagcaactacaatgactggatc
gaaaagaatacagcaaatggaaaaacatgtgattaa

DBGET integrated database retrieval system