KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21401Help
Entry
Dpse_GA21401      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA21401
   04068 FoxO signaling pathway
    Dpse_GA21401
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dpse_GA21401
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dpse_GA21401
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dpse_GA21401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 244 aa AA seqDB search
MSSAIDIDFINSLIDTGPREIKQTTVMFTARKLSQAARSISVRGKHSLPKLAYDYAALEP
IICREIMELHHQKHHQTYVNNLNAAEEQLAEASSKNNTSKIIQLAPALRFNGGGHINHSI
FWQNLSPKKSTPSDDLKKAIESQWKSFDEFKKELSALTVAVQGSGWGWLGYNKKSGKLQL
AALPNQDPLEASTGLVPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDISCRFQEAK
KLTT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgctatcgatatcgattttatcaacagtcttatcgatactggaccaagagaa
attaaacaaaccacagtcatgtttacagctcgcaaactctcccaggcagcgcgcagcatt
tcagtgcgcggcaagcattcgctgcccaagctggcgtacgactatgccgcattggagccc
attatctgccgcgagatcatggagctgcaccaccagaagcaccaccagacctacgtcaac
aacctgaacgcggccgaggagcagctggcggaagcctcgtccaagaacaacacctcgaag
atcattcagctggccccggccctgcgcttcaacggcggcgggcacatcaaccacagcatc
ttctggcagaatctctcgcccaaaaagtccacacccagcgacgacctcaagaaggccatc
gagtcgcagtggaagagcttcgacgaattcaagaaggagctcagcgccctcacagttgcc
gttcagggttctggatggggctggctgggctataacaagaagtcgggtaagctgcagctg
gctgccttgcccaaccaggatcctctcgaggccagtaccggcctggtgcccctcttcggc
atcgatgtgtgggagcacgcctactacttgcagtacaagaacgtgcgtccctcgtatgtg
gaggccatctgggacatcgccaactgggacgacatctcgtgccgcttccaggaggccaag
aagctgactacctag

DBGET integrated database retrieval system