KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24265Help
Entry
Dpse_GA24265      CDS       T01032                                 

Gene name
Dpse_Amy1
Definition
(RefSeq) amylase 1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00500  Starch and sucrose metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dpse_GA24265 (Dpse_Amy1)
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dpse_GA24265 (Dpse_Amy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6898669
NCBI-ProteinID: XP_002138674
FlyBase: FBgn0012691
UniProt: B5DZS7
LinkDB All DBs
Position
3
AA seq 494 aa AA seqDB search
MFLTKTLGCIAFLAIASAQFNTNYVGGRSGMVHLFEWKWDDIAAECENFLGPQGYAGLQV
SPVNENAVKSGRPWWERYQPISYKLTTRSGNEEQFASMVRRCNNAGVRTYVDVIFNHMAA
DGGTYGTAGSTASPSSKSFPAVPYSSLDFNPTCAISNYNDANQVRNCELVGLRDLNQGNS
YVQEKVSDFLNHLIDLGVAGFRVDAAKHMWPADLGVIYGRLKNLNTDHGFASGSRPYIVQ
EVIDMGGEAISKTEYTGLGAITEFRHSDSIGKVFRGKDKLTYMSNWGTGWGFAASDRSLV
FVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPTT
DGQNIASPTFNSDKSCGGGWVCEHRWRQIYNMVAFRNAAGDADLQNWWSNGSNQISFSRG
NRAFVAFNNDNYDLNSSLQTGLPAGTYCDVISGEKSGSSCTGKTVTVGSDGRASISISSS
ADDGVLAIHVNAML
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgacaaagaccctcgggtgcatcgccttcctggcgatcgccagcgcccagttc
aacaccaactacgttggtggccgcagcggcatggtccacctcttcgagtggaagtgggac
gacatcgccgccgagtgcgagaacttcctgggcccccagggctacgccggtcttcaggtg
tcgcccgtcaatgagaacgccgtgaagagtgggcgtccgtggtgggagcgctaccagccc
atctcctacaagctgaccacccgttccggcaacgaggagcagttcgccagcatggtcagg
cgctgcaacaacgccggagtgcgcacctacgtggacgtcatcttcaaccacatggcagcc
gatggcggcacctacggcacagccggcagcaccgccagccccagctccaagagcttcccc
gcagtgccctactcctccctggacttcaaccccacctgcgccatcagcaactacaacgac
gccaaccaggtccgcaactgcgagctggtcggcctgcgtgacctcaaccagggcaactcg
tacgtccaggagaaggtttccgatttcctgaaccacttgatcgatctgggtgtggccgga
ttccgcgtggacgctgccaagcacatgtggcccgcagatctgggcgtcatctatggccgc
ctcaagaacctgaacaccgatcacggcttcgcgtccggatccaggccctacatcgtccag
gaggtcatcgacatgggtggcgaggccatcagcaaaaccgagtacactggcctgggcgcc
atcaccgagttccgccactccgactccatcggcaaggtcttccgcggcaaggacaagctg
acctacatgtccaactggggcaccggctggggcttcgctgcctccgatcgctcgctcgtc
ttcgtcgacaaccacgacaaccagcgcggacacggtgcaggtggtgctgatgtgctcacc
tacaaggtgcccaagcagtacaagatggcctccgccttcatgctggcccatcccttcggc
actccccgtgtgatgtcctccttctccttcaccgacaccgaccagggcccacccaccacc
gacggacagaacattgcctctcccaccttcaacagcgacaagtcctgcggcggcggatgg
gtgtgcgagcaccgctggcgacagatctacaacatggtggccttcaggaacgccgccggc
gatgccgatctccagaactggtggtccaacggaagcaaccagatctccttcagccgtgga
aacagggccttcgtggccttcaacaacgacaactacgacctcaacagctccctgcagacc
ggcctgcccgccggcacctactgcgacgtcatctccggcgagaagagcggctcctcctgc
accggcaagaccgtcactgttggctccgatggacgcgccagcatctccattagcagctcc
gctgacgatggtgtcctggccattcatgtcaacgccatgttgtaa

DBGET integrated database retrieval system