KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_47017Help
Entry
DICPUDRAFT_47017  CDS       T02090                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00250  Alanine, aspartate and glutamate metabolism
dpp00280  Valine, leucine and isoleucine degradation
dpp00410  beta-Alanine metabolism
dpp00640  Propanoate metabolism
dpp00650  Butanoate metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DICPUDRAFT_47017
   00650 Butanoate metabolism
    DICPUDRAFT_47017
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICPUDRAFT_47017
   00280 Valine, leucine and isoleucine degradation
    DICPUDRAFT_47017
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICPUDRAFT_47017
Enzymes [BR:dpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DICPUDRAFT_47017
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     DICPUDRAFT_47017
Amino acid related enzymes [BR:dpp01007]
 Aminotransferase (transaminase)
  Class III
   DICPUDRAFT_47017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Fer4_7
Motif
Other DBs
NCBI-GeneID: 10504187
NCBI-ProteinID: XP_003286793
JGI: Dicpu1_47017
UniProt: F0ZHA7
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MSTSRLVKCLNSNQHIVRSFGSRSTPSSPTPDFIGEYKEPIVKTKTIPGPESKALSEKLN
KVQDPRAAHFFADYANSRGNYIADVDGNVLLDLYCQIASIPIGYNNPELIKAAKSDKWIS
AIINRPSLGVLPPKDWPELIQNSFMQVAPKGLHQVFTAMCGSCANECAYKAVFMHYQHIQ
RNGAPFTEEDLQSCMKNQVPGSPELSILSFKKGFHGRTFGTLSTTRSKAIHKLDIPAFNW
PAATFPDLIYPLEQNEKKNRDIENKCLQEVEHLIKTWPIKVAGLIVEPIQAEGGDNHATP
YFFQGLRDITKKYGVAMIVDEVQTGMGATGKFWAHEHWNLSSPPDIVTFSKKMQAAGFYH
NIEFRPSESYRNFNTWMGDPLRALELEVVIEQIKKNHLLDNVTITGDYLKNGLFDISNKY
PGVLSKIRGDGTFLAIDLPTAAERDAIIAAIRLKGVEMGVCGDKSIRFRPMLICKPNHID
QFLNRFDQTLNELKKN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttcgagacttgttaaatgtttaaattcaaaccaacatatcgttagatcattt
ggttcaagaagcacaccatcttcaccaacaccagattttattggagaatacaaagaacca
attgttaaaactaaaaccattccaggtccagaatcaaaagctttaagcgaaaaattaaat
aaagttcaagacccaagagccgctcatttctttgctgattatgctaattcaagaggtaat
tatattgcagatgttgatggaaatgtattattagatttatattgccaaattgcttcaatc
ccaattggttacaacaacccagaattaattaaagctgctaaatcagataaatggatctct
gcaatcattaatcgtccatcattaggtgttctcccaccaaaagattggccagaattaatc
caaaactcatttatgcaagttgctccaaaaggtttacaccaagtcttcacagccatgtgt
ggttcatgtgctaatgaatgtgcttataaagctgttttcatgcattaccaacacattcaa
cgtaatggtgctccattcaccgaagaagaccttcaatcatgtatgaaaaatcaagtccca
ggttcaccagagctctctattctttcattcaaaaaaggtttccatggtcgtacttttggt
actctttcaactacccgttcaaaagctatccataaacttgatatcccagctttcaactgg
ccagctgctaccttcccagaccttatttacccattagaacaaaacgaaaagaaaaataga
gatattgaaaacaaatgcctccaagaagtcgaacatctcattaaaacatggccaattaaa
gttgctggtttaatcgtcgaaccaattcaagctgaaggtggtgacaaccatgctactcca
tatttcttccaaggtcttcgtgatattaccaaaaagtatggcgttgctatgattgttgat
gaagttcaaactggtatgggtgccactggtaaattctgggctcacgaacactggaacctt
tcatcaccaccagatattgttactttctctaaaaaaatgcaagcagctggtttctatcac
aatatagaattccgtccaagcgaatcataccgtaactttaacacttggatgggtgatcca
ttaagagctctcgaattagaagtcgtcattgaacaaattaaaaagaaccatctcctcgac
aatgtaaccatcactggtgactatctcaagaatggcttatttgatatctctaacaaatac
ccaggtgttcttagcaagatcagaggtgacggtacattcttagccattgacttaccaact
gctgccgaacgtgatgcaattattgctgctattcgtcttaagggtgttgaaatgggtgtt
tgtggtgataaatcaattcgtttccgtccaatgttaatctgtaaaccaaatcacattgat
caattcttaaatagatttgaccaaactttaaatgaattaaaaaagaactaa

DBGET integrated database retrieval system