KEGG   Desulfobulbus propionicus: Despr_1895Help
Entry
Despr_1895        CDS       T01413                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
dpr  Desulfobulbus propionicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2168872..2171766
Genome map
AA seq 964 aa AA seqDB search
MADNEFQGSSGSNEQEQHQQAVRPPAPMQGGPLGGIDPEAVCRVAAGLAGEIDPARATLR
VVLDSSLERDLGFDSLAKVELLSRLEKMSGLTLSEEILTRAETLRDLTRALAQGTAHDRA
AIDHHGTAIERDEQRAGIADRALTLTEVLRLQTQRAPDQPHLLLYGAREEPVTVSHRTLL
DQATAIAAGLEALDVQPGASVALMLPTGLDYFFSFFGVLLAGAVPVPLYPPLRPSQFEDH
LRRHRHILNNCQALLLITVAEARPLARFLKAQVDSLRRIVTVEELQKAGTAFTPVSASPE
DTAFLQYTSGSTGIPKGVILSHANLLTNIRAMGRAIDANPRDIFVSWLPLYHDMGLIGAW
LGSLYHGCQLVAMSPLAFLVHPERWLWAIHRHRGTLSAAPNFGYELCLNKIEPPQLDGLD
LSSWRLAFNGAEPVSAETIARFTDRFAPHGFRPEAMAPVYGLAESTVGLAFPPLGRRPLI
DRVQRQPLLERGLALSAGEDDPHPLRIVACGRVLSGHQLRVVDANDHELPERQVGRLQFY
GPSATSGYYRSPQQTKTLFHGQWLDTGDLGYLAGQDLYLTSRVKDLIIRGGRNISPYELE
EAIGEIEGVRKGCVAVFGNADPTSGTEKLVVLAESRSRDPGMLANLRERIINRSVDILGM
PPDEVVLAPPHTVLKTSSGKIRREASRELYAQGRIGQPPRAVWWQLVRLAAGGLAQQARH
SLRLAASTAYAGACWLLFGLLALTMGPVACVLPSARSRWRVARLAARLLARLTGTGIIVH
GLDRLHTKAPLILVANHQSYLDSLILMAALPLRFSFVAKAELARQTVLRHALARLDVVFV
ERFDFKQAVDDARRLTELAAAGRSLCFFAEGTIWRMPGLHPFHMGAFLVAADNGMEVVPI
TIRGTRTKLRSESWFPRPGQVHLFIGPRLRGEGVGWEAALSLRDRARQQILRHCGEPDLG
GEES
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaacgaattccagggttcttcgggcagcaacgaacaggagcagcatcaacag
gcggtccgaccgccggctccgatgcaaggcggccccttaggcgggatcgatcccgaggcc
gtttgccgagtggctgcggggctggccggtgagatcgacccggcccgcgccacgttgcgg
gtggtgctcgatagctccctggaacgcgatctgggcttcgacagcctcgccaaggtggaa
ttgctctcgcgcctggaaaagatgtccggcctcaccttaagcgaggagatcctgacccgg
gccgaaaccctccgcgacctcacgcgggccctggcacagggcacggcccacgaccgcgcc
gccatcgatcatcacgggaccgcgatcgagcgggacgagcagcgggccggtatcgccgac
cgcgccctgactctgaccgaggtcctccgcctccagacgcagcgggcacccgaccagcct
catcttctgctctacggcgcccgggaggagccggtgacggtcagccatcgtaccctgctc
gaccaggccacggcaatcgccgccggccttgaggccctggatgtgcaaccaggcgccagc
gtggccctgatgctgccgaccggcctcgattatttcttcagtttcttcggcgtgctcctg
gccggcgccgtgccggtgcctctttacccgcccctgcggccctcccagttcgaggaccat
ctccgccgccatcgccacatcctcaacaactgccaggccctgctcctgatcaccgtggcc
gaggcccgtcccctggcccgtttcctcaaggcgcaggtggacagcctacggcggatcgtc
actgtcgaggaactgcagaaggcgggcaccgccttcaccccggtatccgccagcccggag
gacaccgcctttcttcagtacacctccggcagcaccggtattcccaagggggttattctc
agccatgccaacctgctcaccaacatccgtgccatgggccgggccatcgacgccaatccg
cgggatatctttgtcagctggctgccgctctatcacgacatggggctgatcggtgcctgg
ctcggcagcctctatcacggctgccagctggtggcgatgtcgccgcttgccttcctggtc
catcccgagcgctggctgtgggccattcaccgccaccggggcacgctctccgccgcaccc
aacttcggctatgaactctgtctcaacaagattgagccgccacagttggatggactcgat
ctgagcagctggcggctggcctttaacggcgccgaaccggtgagcgcggaaaccattgcc
cggttcaccgaccgctttgccccccatggctttcgtcccgaggccatggcgccggtgtac
ggcttggccgagtccactgtcggtctcgcctttccgcccttgggccgaagaccgctgatc
gaccgggtgcaacggcagcccctgctggagcgcgggctggccctatccgccggcgaggac
gatccccatccgctgcgcatcgtcgcctgcggccgggtcctcagcggccatcagctgcgg
gtggtggatgccaatgaccatgaattgcccgaacgccaggtgggccgcctgcaattctac
ggtccctcggcgaccagcggctactaccgcagccctcaacaaaccaagaccctctttcac
ggccagtggctcgacaccggcgatcttggctaccttgccggacaggatctctacctcacc
agccgggtcaaggatctcatcattcgcggcggccgcaatatctcgccctatgaactggag
gaagccatcggcgaaatcgaaggggtacgcaagggctgcgtggcggtcttcggcaacgcc
gacccgaccagtggcaccgagaaactggtggtgctggccgagagccgcagccgcgacccc
gggatgctggccaatctgcgggagcggatcattaaccggagcgtcgatatcctcggcatg
ccgccggacgaggtggtcctggcgccgccgcacacggtcctcaagacgtcgagcggcaag
attcggcgcgaggccagccgggagctctatgcgcagggccgcatcggccaaccgccgcgc
gcggtgtggtggcagctggtccgtttggccgcaggcgggttggcgcagcaagcacgacac
agtctgcggctggcagcctcgaccgcctatgccggagcctgttggctgctgtttggcctg
ctcgccctcaccatgggcccggttgcctgtgtgttgccgtcggcccgaagccgctggcgg
gttgcccgtctcgccgcccgcttgctggcccgtctcaccggcaccgggatcatcgttcat
ggcttggaccgcctgcacaccaaagctccgttgattctggtcgccaaccaccagagctat
ctggacagcctgatcctgatggctgccctgccgttgcggttcagctttgtcgccaaggcg
gagctggcccggcaaacggtgctgcgccacgcacttgcccggctcgatgtcgtcttcgtc
gagcggtttgacttcaagcaggcagtggacgatgcccgacggctcacggagctggccgcg
gccggccgctcgctgtgtttctttgccgagggtaccatctggcgaatgcccggactgcac
cccttccacatgggcgcttttctcgtcgccgccgacaacggcatggaggtggtaccgatc
accattcgcggcacccggaccaaactgcgctccgaatcctggtttccgcgtcctggccag
gtccatttgttcatcggcccccgtctgcgtggcgagggagtgggctgggaagcggcgctc
tccctgcgtgatcgggcgcggcagcagatcctccgccactgcggcgaaccagatctggga
ggagaagaatcatga

DBGET integrated database retrieval system