KEGG   Deinococcus proteolyticus: Deipr_1251Help
Entry
Deipr_1251        CDS       T01426                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00010  Glycolysis / Gluconeogenesis
dpt00020  Citrate cycle (TCA cycle)
dpt00620  Pyruvate metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_1251
   00020 Citrate cycle (TCA cycle)
    Deipr_1251
   00620 Pyruvate metabolism
    Deipr_1251
Enzymes [BR:dpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Deipr_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 HlyD_3 DUF2254 NQRA RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADY26401
UniProt: F0RNZ2
LinkDB All DBs
Position
complement(1326969..1328786)
Genome map
AA seq 605 aa AA seqDB search
MATELKLPDVGDNIEQGTVVTILVNPGDTVAEGDPIIEIETDKAVVEVPATAGGTVESVA
VKVGDKVAVGGTILTLSGGDAGAAQATGAAQASDTVTPAQGGGDQAALQEDSSAVSADSA
QANQVAAEQQRAQQAEASGEAAQAQGAGTASSQPGSAPQAGSQQATLPDVGDNIEQGTVV
TILVNPGDTVAEGDSIVEIETDKAVVEVPSNAAGTVQEIAVKVGDKVQVGGTLLTLSGGS
SAGSAPAAPAPAQAQSNAVAAEQQQAQQAEASADAGKPAAQAAAPQQSGTQNPKTYEGRP
IVPAAPSVRRLAREMQVDIHAVQGTGIAGRISEEDVRRSAGRPSVQPAAAPAAAPAAVSA
PAAQPLPDFSKWGQVTREDMNGIRKATVRSMSTAWSTIPMVTHFDKADVTVMEETRRRFG
ERVQKAGGKLTMTHILMKVVANALHKFPKFGASLDLRNEQVVFKDFVNIGVAVDTPVGLL
VPVVKDADKKSITELVLDLTDLAERARDRKLKPDEMQGATFTISNLGGIGGHAFTPIVNS
PEVAILGVSRGGMEPVWNKETGEFEPRNMLPLSLTYDHRLIDGADAARFLRFICESLEDP
FLISL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaactgaaactgcccgacgtgggcgacaacatcgaacaaggcaccgtcgtg
accatcctggtgaacccgggcgacaccgtggccgagggcgaccccatcatcgaaatcgag
accgataaggctgtggtggaagtgcccgctacggccggcggtaccgtagagagcgtggcc
gtcaaggtaggcgacaaggtggccgtgggcggcaccatcctgaccctgagtggtggggac
gccggcgcagctcaggcaaccggtgcagcccaggcgagcgacaccgtgactccggcccag
ggcggcggtgaccaggccgcgctgcaggaagacagcagtgccgtgagtgcggacagtgct
caggccaatcaggtggctgccgagcagcagcgtgcccagcaggcggaggccagtggtgaa
gcggcccaggctcagggcgctggtactgcctccagccagcctggcagcgctccgcaggcg
ggcagccagcaggccaccctgcccgacgtgggcgacaacatcgaacagggcaccgtagtc
accattctggtgaaccccggcgacaccgtggccgagggtgactccatcgtcgaaatcgaa
accgacaaggccgtggtggaagtgcccagcaacgccgctggcaccgtgcaggagattgcc
gtgaaggtgggcgacaaggtgcaggtgggcggcacgctgctcaccctcagcggaggcagc
agcgcaggcagtgctcccgccgctcccgcgcccgctcaggcccagagcaacgccgtggct
gccgagcagcagcaggcccagcaagccgaggcaagtgctgacgccggcaagcctgccgcc
caggctgccgcaccccagcagtcgggcacccagaaccccaagacctacgaaggccgtcct
atcgtgcccgccgctcctagtgtgcgccgcctggcccgcgaaatgcaggtggacattcac
gctgtgcagggcacgggtattgcaggccgtatcagcgaggaagacgtgcgccgcagcgcc
ggccgccccagcgtgcagccggccgcagcccctgctgcggcgccggccgccgtgtctgct
ccggctgcacagccgctgcccgacttcagcaagtggggccaggtcacccgcgaggacatg
aacggaatccgcaaggccaccgtgcgctccatgtccaccgcctggagcaccatcccgatg
gtcacccacttcgacaaggccgacgtgaccgtgatggaagaaacccgcaggcgcttcggc
gagcgggtgcagaaggcgggcggcaagctcaccatgacccacatcctgatgaaggtggtg
gcgaacgccctgcacaagttccccaaattcggggccagcctcgacctccgaaacgagcaa
gtcgtgttcaaggacttcgtgaacatcggcgtggcggtagatacccccgtcggcctgctg
gtgcccgtggtcaaggacgccgacaagaagagcatcaccgagctggtgctggacctgacc
gacctggccgagcgtgcccgtgaccgcaagctcaagcccgacgagatgcagggcgcgact
ttcaccatttccaacctcggcggcatcggcgggcacgcctttacccccatcgtgaacagc
cccgaagtggcgattctcggcgtgtcacgcggtggcatggagcccgtctggaacaaggaa
acgggcgagttcgagccgcgcaacatgctgccgctcagcctgacctacgaccaccgcctg
attgacggggccgacgcggcccgcttcctgcgcttcatctgcgagtcgctggaagacccc
ttcctgattagcctctga

DBGET integrated database retrieval system