KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_194595Help
Entry
DAPPUDRAFT_194595 CDS       T04347                                 

Gene name
HDA6
Definition
(GenBank) putative histone deacetylase HDAC6 protein
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
dpx  Daphnia pulex (common water flea)
Brite
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DAPPUDRAFT_194595 (HDA6)
Protein phosphatases and associated proteins [BR:dpx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DAPPUDRAFT_194595 (HDA6)
Messenger RNA biogenesis [BR:dpx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     DAPPUDRAFT_194595 (HDA6)
Chromosome [BR:dpx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     DAPPUDRAFT_194595 (HDA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1022 aa AA seqDB search
MSKQTKFSNFVKGRSPSNKKNEKLNVFVDHLQNTRDSKDKIRGKTGIVYDERMVEHQCLW
DPNYPECPERFTRVLERCREYGLAQRCVEIQPRKATQDELLKLHTPDRIELLKGTDGSPD
AEALEAISSGYDAIYIHPSTNELALLAAGSTVEMVDALLDGKIQNGMAVIRPPGHHAMKS
EYCGYCFFNNVAVAAQHALDNKGVEKILIVDWDVHHGQATQQMFYEDPRVLYFSVHRYEH
GAFWPNLRESDFHYIGSGAGKGFNVNVPLNKTKMGNADYLAIWHQLLLPLAYEFQPELII
VSAGYDAALGCFEGEMEITPACYSHLTSSLMGLAQGKLAVVLEGGYCLKSLAEGAALTLR
TLLGDPCPVIAKIEQPCQSIQESILSAIYVLRPMWKCLQFQGRFDASKVGSQKEGKHFVP
SVTFEGSDIKQTFFATRNCYPVQNNETIDLLDQRLDKLIKETSLAVPKHRVCFIYDERMA
LHRNINEPGHPERPARITSIYQKLMEFGVLERCHRLDARDADREELLWLHQADYIDEIAA
TAGKKQSTLNQLERQYGSIFICPETYQAALLSAGSSLQIVESILSGESRSGIGVVRPPGH
HAECDEAYGFCFFNNTALAAKYAIEIHHLERILIVDWDVHHGNGIQRMFEEDPRVLYISL
HRFDIFPFKPEESDCSVVGSGSGAGYTVNIAWPKRGMGDTEYLAAFQQIIMPIAYQYNPQ
LVLVAAGFDAAQGDPLGGCKITPEGYGQMTNMLSSLAQGRVAILLEGGYNLDSISHSMTM
CAKALLGDPLPSPRIEPLNPAAISTIKQVVSHLLPYWSSLCFHVDLPEGNVLPPCEVTKK
PLSIEEQLEKLQLESSGATSQETETIVEGTVLLLEACGVTESAPPKTLQEFLLLPENVEA
MKEGTLFSVVPLSWCPHIEGHVLPDDNVANPWSLQTPCSCCQDKSENWVCLSCYQVNCGR
FVKGHMKEHHNESGHSLVLSFSDLSIWCYECDSYVDNRAFYSAKNRLHVEKFGEPLPPSF
SG
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaaacaaagttttcgaatttcgtgaaaggtcgctcaccatcaaataaaaaa
aatgaaaaattaaatgtgtttgtggatcacttgcaaaatactcgggattctaaagataag
atacgtggcaaaacaggaattgtttatgatgaacggatggttgaacaccagtgtctttgg
gatcccaattaccctgaatgtccagagagattcacacgggttttggaaagatgccgtgag
tatggtttggctcaacgctgtgtagaaattcaacctagaaaggcaactcaagatgagctg
ttgaaacttcacacaccagacagaattgaattgctcaaaggaacagatggcagtccagat
gctgaagcattagaagctattagctctggttatgatgccatttacattcatccatcaaca
aatgagctagcattgttggcagctggatcaacagttgagatggttgatgctttactggat
ggaaagatacaaaatggaatggctgtaatcagaccaccagggcaccatgcaatgaaaagt
gaatactgtggctattgtttcttcaacaatgtagcagttgcagctcagcatgcattagat
aacaagggtgttgaaaaaattctgattgttgattgggatgttcaccatggccaggcaact
caacaaatgttctacgaagaccccagagtcttatatttctcggttcatcgttatgagcac
ggagctttttggcccaatcttcgtgaaagcgattttcactatattggaagtggagcaggc
aaaggctttaacgtgaacgtgccactgaataaaacgaaaatgggtaacgccgactatctg
gccatttggcaccagctgctattgcctctggcttatgaatttcaaccagagttgattatt
gtatcagccggctatgacgctgccttgggttgtttcgagggcgaaatggaaatcactccc
gcgtgctactcccacttgacgtcatcactcatggggctggcccaaggcaaactggctgtc
gttctcgaaggagggtactgcctgaaatctttggccgaaggagctgctctgaccttgcga
acattgcttggtgatccttgcccagtcatcgcgaaaatcgaacagccttgtcaaagtatt
caggaaagtattttgagcgctatttatgtgcttcgccctatgtggaaatgtctacagttc
cagggccgttttgatgcttcgaaagtgggtagtcaaaaggaaggaaagcactttgtaccc
agtgtcacttttgaaggatctgacatcaaacaaacattttttgccactcgaaactgttac
ccagtgcagaacaatgagacgattgacctcttggatcaacgccttgataaactcattaaa
gaaacgagcttggcagtccctaagcatcgggtgtgtttcatctacgatgagagaatggct
ttgcatcgtaacattaatgaacctggacatccggagagacctgctcgaatcacttcaatc
taccagaaattgatggaattcggagtgttggagcgctgccaccggctagatgctcgagat
gccgatcgcgaagaattgctgtggttgcatcaggccgactacatcgatgagattgcggca
accgccggtaaaaagcaatcgactctcaaccagttggaacggcagtacggatccatcttc
atctgtccggaaacctatcaggctgcgttgctctcagctggctcgtcgctccaaattgtt
gaaagtattttgagcggtgagagtcgtagtggaataggagtcgtccggccaccggggcac
cacgcagaatgcgatgaagcgtacggcttttgtttcttcaacaacacggcgctggcagcc
aaatatgccatcgagattcatcatttagaaagaatccttatcgtcgattgggatgtacac
cacggcaacggaatccagcggatgtttgaagaggatccacgcgtattgtacatttccttg
catcgctttgacatcttcccgttcaaaccggaagaatctgattgcagcgtagtaggaagc
ggatccggtgctggatacacagtcaacatcgcttggcctaaaagagggatgggcgacacg
gaataccttgctgcgttccagcagattattatgcctatcgcttatcaatacaatccgcag
ttagtcctcgttgcagctggattcgatgcggctcagggggatcctttgggaggctgcaag
attactccggaagggtacggacaaatgacgaacatgcttagttcacttgctcaaggacgt
gttgctatcctactcgaaggcggctacaatttggattccatttcgcactcgatgaccatg
tgtgccaaagctttgctaggagacccattgccttcgccaagaatcgaaccactcaatccg
gcagccatcagcaccatcaagcaggtcgtcagccatttgctaccttattggagtagcctc
tgcttccacgttgatctacccgaaggaaatgttctcccgccttgtgaagttacgaaaaag
ccgctcagtattgaagaacaattggagaaactccaactcgagtcatcaggagcaaccagt
caggagacagaaactatcgtagagggtactgtgctattgctggaagcttgcggtgtgact
gagtctgctcctccaaaaacacttcaggaattcttgctgttgccagaaaatgttgaggct
atgaaggagggtacgctgttttctgtggttcctttatcgtggtgtccacatatagaagga
cacgttctacccgatgataatgtcgccaatccttggagccttcaaactccttgctcatgt
tgccaggataagtcagaaaactgggtctgcctatcttgttatcaggtcaactgtggacgg
ttcgtaaaaggtcacatgaaggaacatcataacgagagtggtcattcgctggttctcagt
ttctctgatctgtcaatctggtgttacgaatgtgattcctacgtcgataatagggcattc
tattcagccaagaaccgactacatgtggagaagtttggcgaacccttgccaccttcgttt
tcaggttga

DBGET integrated database retrieval system