KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_306022Help
Entry
DAPPUDRAFT_306022 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpx  Daphnia pulex (common water flea)
Brite
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     DAPPUDRAFT_306022
Peptidases [BR:dpx01002]
 Metallo Peptidases
  Family M2
   DAPPUDRAFT_306022
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAPPUDRAFT_306022
CD molecules [BR:dpx04090]
 Proteins
  DAPPUDRAFT_306022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 653 aa AA seqDB search
MRRFLLLAMALCYASARNITSTPNTRYIQGNNTDEKEALNFLLAYDREASAMCNNVMNTQ
WDFNTNITESTKQRMLETQLEYAKFQKDVWATATTFKWKTFRDPSIRRQFKVLSVLGRAA
LPEEKLKEIQQLLADMRDIYSRNRVCPYVKQPKNASLPIRMESVKCNLALDPDLTRIMAK
SKDDNELTYMWQQWHDETGRPLRSKFMRYVELSNEAARLNGFKDTGDQWRASYDIEDFNS
ELDELWMGLRPLYQQLHAYVRRRLHHQHGKIVPLDGPIPAHLLGNMWAQSWSNLYDTTVP
FPNKNSMDVTLSLKRQGYDPVRMFQLADQFFVSLGMKSVPDSFWTASMLEKPLDREVVCH
ASAWDFCNGRDFRIKQCTEVTMEDLTTAHHELGHIQYYMQYVNQPLAFREGANPGFHEAI
GDVVALSVSTPKHMQKIGLLDKAADDPEVDINYLYSMALDKIAFLPFGFLLDQWRWKVFS
GEIPFDQMNKAWWDLRLRYQGVAPPVNRSEHDFDAGAKYHVPANTPYIRYFVSFVLQFQL
HKVLCEASGHVGPLHKCDIYQSREAGKLLAELLKLGSSKPWPDAIRILTRGRTSRMDPGA
IMEYFQPLMEWLQKQNTEEKAGWRGMNSGITIKTTWVAVVLSFVITLVFSRLW
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagacggttcttattgctggcgatggcgctatgttacgcctctgcacgcaacatcact
tcaacccccaacaccagatacattcaggggaataacaccgatgaaaaagaggctctcaat
ttcttactggcatacgatcgcgaagcaagtgccatgtgtaacaatgttatgaacacccaa
tgggatttcaataccaacatcaccgagtctaccaaacagcgaatgttggaaacgcaactg
gaatacgccaaatttcaaaaggacgtctgggcgaccgctacgactttcaaatggaagacg
ttccgcgatccgagtatccgtcgccaattcaaggtgctttctgttctcggtagagctgct
cttccagaagaaaaactcaaagagattcaacagcttctggcagatatgcgagacatttat
agtcgcaatcgagtttgtccttacgttaagcagcctaagaacgcgtcactaccgatccga
atggagtcagttaagtgcaaccttgcactcgatcctgatttgacccgcatcatggccaaa
tccaaagatgacaatgaattaacctacatgtggcaacaatggcacgatgaaactggacgg
ccccttcgatccaaattcatgcgctacgttgagttatctaacgaggctgctcgtttaaac
ggtttcaaggatactggagatcaatggagggcctcatacgatatcgaagatttcaattca
gagctcgacgaactctggatggggttgaggccactataccagcagctacacgcctacgtc
cgccgaaggttgcatcaccaacatgggaagattgtacctctagatggaccgatccctgct
catttgttgggcaacatgtgggctcagtcatggagtaatttatacgatacaacggtccct
ttccccaacaaaaatagcatggacgttaccctgagtctcaagcgccaaggctatgatccg
gtgcggatgttccaactcgctgatcagttcttcgtctcgctgggtatgaagtctgtccct
gattcgttctggactgcatcgatgctagaaaaaccgctagatcgcgaagtagtatgtcat
gcgtcggcttgggatttttgcaacggacgcgacttccgcatcaaacagtgcacagaagtc
accatggaggatttgactactgcccaccacgaactaggacatattcagtactacatgcaa
tatgtgaatcaaccgttagccttcagggaaggtgctaacccaggttttcacgaagcaatt
ggagatgtcgtcgcgttgtccgtctcgacacccaagcacatgcaaaagataggcttattg
gataaagcagccgacgatcccgaagtcgatatcaattatctttattctatggctctggat
aagattgctttcctaccttttggatttctgcttgatcagtggcgctggaaggtgtttagc
ggtgaaattccgttcgatcaaatgaataaggcgtggtgggatctccggcttcgctatcaa
ggcgtggcacctcctgtgaatcgtagtgaacatgattttgatgcgggtgccaaatatcat
gttccagccaacacaccttatatcagatatttcgtcagttttgtactccaattccaactg
cacaaggtgctatgcgaagcttccggtcacgtgggaccgttgcataaatgtgatatttat
cagtcacgagaagccggaaaactattggcagagctgttgaagttgggctcatctaaaccg
tggcctgatgccatccgcattctcactcgcggtcgaacgagccggatggatccaggagcc
atcatggaatactttcaaccgttaatggaatggctccagaaacagaatactgaagaaaaa
gccgggtggagaggaatgaatagcggaatcacaatcaaaaccacttgggtcgccgttgtg
ctctcgttcgtcataactttggtattttcaagattgtggtag

DBGET integrated database retrieval system