KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_347804Help
Entry
DAPPUDRAFT_347804 CDS       T04347                                 

Gene name
TRY4A
Definition
(GenBank) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpx00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    DAPPUDRAFT_347804 (TRY4A)
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     DAPPUDRAFT_347804 (TRY4A)
Peptidases [BR:dpx01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   DAPPUDRAFT_347804 (TRY4A)
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAPPUDRAFT_347804 (TRY4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MKFLILVCCLLSCAAGNSLFPRLPLFYRTDQPSLLSGEKIVGGTQATPNEFPWQISLQRR
GVLSSYSHSCGGSVYNNNYIIDASHCVDGVTDVGTLRVVAGEHSLTQTSGYEQIRSVLSY
KMHESYNSNTFANDIALLKLSSPLDYSTGKVGAINLPAQGATIETGTTCLVTGWGTTIAG
GGGSVSDVLRKAAVPIVSNSDCNSMYGGNSILPSMLCAGFVAGGIDSCQGDSGGPLVTLN
PNVLVGVVSWGNGCANPGYPGVYTRVASFTNWIKTNAV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctgattctagtttgctgcctcctttcatgcgctgcaggtaactccttgttc
ccgcggctgccattgttttacaggaccgatcagccgtcactcctcagcggagaaaaaatc
gtcggcggcacccaggccactcccaatgaattcccctggcaaatatctctccagagacgc
ggcgttttgtcgtcctattcccacagttgcggaggatccgtctacaataataattacatc
attgacgcctctcattgcgtggacggggtcactgatgtcggcacattgcgggtagtagcc
ggcgaacacagtttgacacagacttccggctacgaacagatccgttctgtgttgtcctat
aaaatgcacgaaagttacaattcgaatacatttgccaacgatatcgccctcctcaaattg
agttcgccgcttgattactcaaccggcaaagtcggtgcgatcaatctgccggcccaggga
gcgactatcgaaaccggaacaacatgtctggttaccggatggggcaccacgattgctggc
ggtgggggttcagtctcggatgtgttgcgcaaagcggccgtgcccatcgtttccaacagc
gattgcaattccatgtacggaggcaattccattttgccgtccatgttgtgcgctggattc
gtagccggtggaatcgattcttgccaaggggattcgggaggacccttggtcacgttgaat
cctaacgtcctagtcggtgtcgtctcttggggaaacgggtgcgctaatccaggatatccg
ggcgtctacacgagagttgcgtcatttactaactggatcaagactaacgctgtataa

DBGET integrated database retrieval system