KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_05630Help
Entry
BA022_05630       CDS       T04937                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00010  Glycolysis / Gluconeogenesis
dpy00071  Fatty acid degradation
dpy00350  Tyrosine metabolism
dpy00625  Chloroalkane and chloroalkene degradation
dpy00626  Naphthalene degradation
dpy01100  Metabolic pathways
dpy01110  Biosynthesis of secondary metabolites
dpy01120  Microbial metabolism in diverse environments
dpy01130  Biosynthesis of antibiotics
dpy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA022_05630
  Lipid metabolism
   00071 Fatty acid degradation
    BA022_05630
  Amino acid metabolism
   00350 Tyrosine metabolism
    BA022_05630
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BA022_05630
   00626 Naphthalene degradation
    BA022_05630
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BA022_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ASI68103
LinkDB All DBs
Position
1243894..1244925
Genome map
AA seq 343 aa AA seqDB search
MPAKTMKAAVVREFGKPLTIEEVPVPAPTADQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAVGANVKHVKEGDRVGVPWLHSACGCCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPNYVGHLPKDVGFVDIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGG
LGHMAVQYARAMGLNVAAVDVDDDKLALARQLGASVTVNARDTDPAAFLQKEIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGVTVRGSIVGTRLDLQES
LDFAARGQVKATVRTEKLENINDVFARMHKGQIQGRVVLDMAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaagacaatgaaagccgccgtggtccgtgaattcggcaagccgctgacgatc
gaagaggtgcccgtgcccgcccccaccgccgaccagatcctggtgaagatcgaggcctcg
ggcgtgtgccacaccgacctacacgccgccgagggcgactggcccgtcaagcccaatccg
cccttcatcccggggcatgagggcgtgggcttcgtcgccgccgtgggcgccaacgtcaag
catgtgaaggaaggcgaccgcgtgggcgtgccctggctgcactcggcctgcggctgttgc
acgcactgcctgggcggttgggagacgctgtgcgagtcgcagagcaacacggggtattcg
gtcaacggcggttttgccgactacgcgctggccgaccccaactacgtgggccacctgccg
aaagacgtgggcttcgtggacatcgcccccgtgctgtgcgccggcgtgaccgtgtacaaa
ggcctgaaggtgaccgacaccaagcccggcgactgggtggcgatttccggcattggcggc
ctgggccacatggccgtgcagtacgcccgcgccatggggctgaacgtggctgcggtggac
gtggacgacgacaagctcgcgctggcccgccagctgggcgccagcgtgacggtgaacgcg
cgcgacaccgacccggccgccttcctgcaaaaggagatcggcggcgcgcacggtgcgctg
gtcacggccgtgtcgcccaaggccttcgagcaggcgctgggcatggtgcggcgtggcggc
acggtgtcgctcaacgggttgccgccgggcaacttccctctgcccatcttcgacatggtg
ctgcgcggcgtgaccgtgcgcggctccatcgtcggcacgcgtctggacctgcaggagtcg
ctggacttcgccgcgcgcggccaggtgaaggccacggtgcgcaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcgtggtgctggac
atggcggcctga

DBGET integrated database retrieval system