KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_08910Help
Entry
BA022_08910       CDS       T04937                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1947456..1952792)
Genome map
AA seq 1778 aa AA seqDB search
MTTQPVSQENVFVHPANFIERLQQLVANRPEDVALTVVAERDDQLVETALTYRVFGHRVH
ALAAVLQGRFEKGDRVLILLDNDEHYAVSMFACFHAGVIAVPVFPPESARPQHLARLAGI
AADAQARGILTLSSLQALVGAAASQFGVSTVVAVDQVDPAIASDWRPHQPAGEDVAFLQY
TSGSTSAPKGVMVTHGNLMANERAIREGLSIGADDKFGVWSPLFHDMGLIGGLLQPFYSG
IPCVLSSPRFFLERPLRWLEMISRHRVTISGGPDFAYRLCLDRVKEAQTEGLDLSSWRVA
YTGAEPVRHDTMDAFIERYAPVGFSAGAVYPCYGLAEATLFITGGRRGTGMVVSRFDTEA
LAKRKVAVDADGAALVGCGSVPSEHEVRIVDPQSGEIAAEGAIGEIWAAGPSMAAGYWNK
PHETAEAFVESAGCRWLRTGDLGFVHDGQIFVAGRLKDMIIVRGHNIYPQDIERVVEAEV
EAVRKGRVAAFAVNFDGQEGVGVAAEVSRGLQKLVPPQVLVDALSIAVSEQCGEAPKAVV
LLNPGALPKTSSGKLQRAACRKGWAERSLDAYAIFESGCFVLGAGLTGGNPATGDDAVQD
ETVQTLAGMWRQVLGHESTRNYGSDAHFFTQGGNSLAAVQLAAHISQKWSIDFPVRQVFE
LPRLGAQAEGVRACQKTGARTSVVAIPVLPAERRTEPLPLSSAQQRQWFLWRLDPLSTAY
HVQGALRIAGALDVETMRLAVDDLAKRHESLRTVFRARPDGEVEQIVRAGGGLDLQMFDL
RSVVCEERETHAAETLQALQTQPFDLTAGPLVRAALVRLEDQVHILALVMHHIVSDGASM
QVLVDELAAMYAARQAGGEALPTPAVQYADYAVWQHDHPDQESRERQLAYWLKQLGVPPG
EAQPVLALPADHPRQAVARYRAGQHGFELPKGLVAGLRGPAEAHGATLFMVLLAALQALL
HRYSGQHDIRVGVPVANRSRAELQSVVGFFVNTLVLRNSVEGRMSLAQVLAQARETALGA
QTHQELPFEQIVEALRPERNLGATPLFDVMFNHLQRDLSPLQRRLGWSVSEMSIGNEHAQ
FELTVDTSEDADGRVHVSFTYAKELFEAGTIERMAGHYVAVLQALAERPEQAVGDVELLG
EAERRQLQAWGENVQRYPNAEPVHRLIERQARAHPEAVALLFGDEVLSYGELNTRANRLA
HRLIQLGVGPEVKVGIAVERSLEMVVGLLAILKAGGAYVPLDPEYPADRLAYMVEDSGIG
LLLTQGAVKDRLPAAEGLTVLELDGLDVADESTHNPEVAVHGENLAYVIYTSGSTGRPKG
AQLCHRNVTRLLGSTDAWFRFGTNDVWTMFHSYAFDFSVWEIFGALCSGGQLVIVPYWVS
RSPEDFLQLLRRHRVTVLNQTPSAFGQLMNVPGLYDERLALRAVIFGGEALDPQRLRPWV
EHWGDQSPQLINMYGITETTVHVTYRQITEADLQGQRSPVGVAIPDLGLRVLDGSLNLAP
IGVAGELYVAGDGLARGYLGRSGLSAERFVADPFDEAGGRLYRTGDLVRWNGEGQLEYLG
RIDHQVKIRGFRIELGEVEAQLLSQPEVREAVVVAKEGPGGARLVGYVSAQAGQAIEAGE
LRERLGKQLPDYMVPSVLVVLESLPLNANGKVDRKALPEPGFESEHEYEAPQGEVEEALA
KIWAEVLGVERVGRHDNFFDVGGHSLLLLKVHRRIGHELKVELSVIDLFKYSTVGAAAAF
LREGGGQTSADTQRVNDRARRQKGAFLVRKPVAERIPT
NT seq 5337 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacagcccgtgtcgcaagagaacgtatttgttcaccctgcgaactttatcgaa
cgcctgcagcaacttgttgccaaccggcctgaggatgttgcgctgaccgtcgttgcggaa
cgcgacgaccaactcgtcgagacggccttgacctatcgcgtcttcgggcatcgcgtgcat
gcgctcgccgccgtgctgcagggccgtttcgagaagggcgatcgggtactgatcctgctc
gacaacgatgagcactatgcggtcagtatgtttgcttgctttcatgcgggcgtgatcgca
gtgccggtattcccgccggagtcggcgcgaccgcagcatctggctcggctcgccggtatt
gccgcggatgcccaggcgcgggggatcctgaccttgagttcgctccaggcgctggtgggg
gccgctgccagccagttcggtgtgtcgacggtggtggctgtggaccaagtcgatccggct
atcgccagcgattggcgcccgcaccaacctgccggcgaagacgtcgccttcctccagtac
acgtccggctccacctcggcccccaaaggggtgatggtgacgcacggaaacctgatggcc
aacgagcgggcgatccgtgagggactctcgatcggcgccgatgacaaattcggcgtgtgg
tcgccgctgttccatgacatgggcctgatcggcggactgctgcagcccttctacagcggc
attccctgcgtgctgtcttcgccgcgcttcttcctcgagcgcccgctgcgttggctggag
atgatctcgcgccatcgggtaacgatcagcggcggtcccgactttgcataccggctgtgc
ctggatcgggtcaaggaggcgcagaccgaggggctggatctgtcgagctggcgcgtggcc
tacaccggcgccgagccggtgcggcacgacacgatggatgccttcatcgaacgctatgcc
ccggtgggattcagcgccggtgcggtgtatccctgctatggcctggccgaggccacgctt
ttcatcacgggtgggcgccggggcaccggcatggtggtgagccgcttcgataccgaggcg
ctcgcgaagcggaaggtggccgtcgacgccgatggtgcggcgttggtcggctgcggcagt
gttccctcggagcatgaggtgcgaatcgtcgatccgcaatccggcgagatagccgccgag
ggtgccatcggcgagatctgggccgcggggcccagcatggccgcgggctactggaacaag
ccgcatgaaactgcagaggctttcgtcgagagcgccggatgtcgctggctgcgcactggt
gatctgggcttcgtgcatgacgggcagatcttcgtggccgggcggctcaaggacatgatc
atcgtgcgtgggcacaacatttacccgcaggacattgagcgcgtggtcgaggccgaggtc
gaggcggtgcgcaaaggccgggtagctgccttcgcggtgaactttgatggacaggaaggc
gtcggcgtcgctgccgaggtctcgcgagggttgcagaagctcgtgccgccgcaggtgctg
gttgatgccctgagcatagcggtgagcgagcagtgcggcgaggcaccgaaggcggtcgtg
ctgctcaaccccggggccttacccaagacgtccagcggcaagctgcagcgcgctgcctgc
cgcaaagggtgggcggaacgctcgctcgatgcctatgcgattttcgagagcggatgcttc
gttttgggcgcaggcctgaccggtggcaatccggccacgggcgatgacgccgttcaggac
gagacggtgcagacgctggccggcatgtggcgtcaggtgcttgggcatgagtcgacgcgg
aactacggcagcgatgcgcacttcttcactcagggtggcaactcgctggctgccgtgcaa
ctggcagcgcatatctcgcagaagtggagtatcgatttcccggtccggcaggttttcgag
ctgccgcgtcttggggcgcaggccgagggcgttcgggcttgccagaaaaccggtgcgcgg
acgtcggtggtggctattccagtcctgcccgcggagcgtcgcaccgagcccttgcctttg
tcttcagcccagcagcggcagtggttcctgtggcggctcgatccgttgagcaccgcctac
catgttcagggcgcgctacgcatcgcaggtgcactggatgtagaaaccatgcggctggcc
gtcgatgatctggccaaacggcatgaatcgttgcgcaccgtgttccgtgcgcggccggat
ggtgaagtcgagcagatcgttcgtgccggcgggggcctggaccttcagatgttcgacctt
cgcagcgtggtgtgtgaggagcgggaaactcacgcagcagaaacgctgcaagcgctccag
acgcagcccttcgatctgacggccggtcccttggttcgggcggcgctcgtgcgactggaa
gatcaggttcacatcttggcactggtgatgcaccacatcgtttccgacggtgcctcgatg
caggttcttgtcgacgaattggctgcgatgtacgcggctcgacaagctggtggtgaggcg
ttgccaactcctgcggtccagtatgcggactacgctgtctggcaacacgaccatccggac
caggagtcgagagaacggcagctggcgtactggctgaaacaactcggcgtgccgccaggc
gaagcgcagccggttctggccttgcccgccgatcatccgcgtcaggcggttgcccggtac
cgggcggggcaacacggcttcgaactccccaaggggctggtagcaggcttgcgcgggccg
gcggaagcccatggcgccacgctcttcatggtgttgctggcagctcttcaggcactgctg
caccgttactccggccagcacgacatccgtgttggcgtgccggtggccaaccgctcgcgt
gccgagctccagagcgtagtggggtttttcgtcaacacgctggtgctgcgcaatagcgtc
gaggggcgcatgagcctagcccaggtgctggcgcaggccagggagaccgcgcttggtgct
caaacgcatcaggaactgccattcgagcagatcgtggaggcattgcggccggagcgcaat
ctgggcgcaactccgctcttcgacgtgatgttcaaccacttgcagagggatctttcccca
ttgcagcggcggttgggctggtcggtgtccgaaatgtctatcgggaacgagcatgcgcag
ttcgaactgacggtcgacaccagcgaagacgctgatggccgggtacatgtgagcttcacc
tacgccaaggagttgttcgaggcgggcacgatcgagcggatggcggggcactacgtggcg
gtactgcaggcgctggccgagcgtcctgagcaggcggttggggatgtggagctgctaggt
gaagctgagcgtcgacaactccaagcgtggggtgagaacgtacaacgctacccgaacgcc
gagccggtacaccggctgatcgagcggcaagcccgggcccatcctgaagcggtggcattg
ctctttggcgacgaggtgctgagctacggcgagttgaacacgcgggccaaccggttggca
catcggctgatccagctgggtgtgggcccggaggtgaaggtcggcatcgcggtggagcgc
tccctcgagatggtggtgggactgctggcgattctgaaggccggcggggcgtacgtgccg
ctggacccggagtacccggcggatcggctggcctacatggtcgaggacagcgggattggg
ttgctgctgacgcagggcgcggtgaaggatcggctgccggcggccgaagggctgacggtg
ctggagctcgacgggctggatgtggcggacgagtccacgcacaaccccgaagtggcggtg
catggggagaacctggcgtacgtgatctacacgtcggggtcgacaggaagacccaaaggc
gcccagctctgccatcgcaacgtcacgcggctactcggcagcacggacgcgtggttccgg
ttcggtacgaacgacgtctggacgatgttccactcctacgccttcgacttctcggtctgg
gagatcttcggcgcgctatgcagcggcgggcaattggtcatcgtgccctactgggtcagc
cgctcgccggaagacttcctgcaactgctgcgccggcatcgggtgacggtactcaaccag
accccctcggccttcggccagctcatgaatgtgcccggcctctacgacgagcgcctggcg
ctgcgcgccgtgatcttcggcggcgaagcgctggacccacagcgactgcgcccgtgggtc
gagcactggggagaccagagcccacagctgatcaacatgtacggcatcaccgagacaacc
gtacacgtcacctaccgccagatcacggaagcggacctgcagggccagcgcagcccggtc
ggcgtagccatcccggaccttggcctgagggtgctggacggctcgcttaacctcgcaccg
atcggtgtggcaggcgagctgtacgtggccggcgacggcttggcgcgaggctacctgggt
cgttcggggttgagcgcggagcggtttgtagcggacccgttcgatgaggcgggagggcgg
ctgtaccgcacgggcgacctggtgcggtggaacggcgaagggcaactggagtacctgggt
cggatcgaccaccaggtcaagatccggggcttccgcatcgagctgggagaagtggaagcg
cagttgctgtcgcagcccgaggtgagggaagcggtggtggtggccaaggaagggccgggc
ggggcgaggctggtgggctacgtgtcggcgcaggccggacaggcgatcgaagcgggtgag
ctgcgcgagcggctgggcaagcaactgccggactacatggtgccgagtgtgctcgtggtg
ctggagagcctgccgctcaatgccaacggcaaggtggacaggaaggcgctgccggagccg
gggttcgagagcgagcacgaatacgaagcgccgcaaggggaagtggaagaggcgctggcc
aagatctgggccgaggtgctgggtgtggagcgcgtgggccgacacgacaacttcttcgat
gtcggcgggcattctctgctgctgctgaaagtgcaccgtcgaatcgggcacgagctgaag
gttgagctctcggtgatcgacctattcaagtattcgacggtaggggctgcggctgcgttt
ttgcgtgaaggcgggggtcagaccagcgcggatacacaacgtgtgaacgaccgcgcgcgc
agacagaaaggtgcatttctggtgcgaaaacccgtcgccgaaaggattcccacatga

DBGET integrated database retrieval system