KEGG   Danio rerio (zebrafish): 101886595Help
Entry
101886595         CDS       T01004                                 

Gene name
b3galt4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    101886595 (b3galt4)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     101886595 (b3galt4)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Glycolipid
   101886595 (b3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
LinkDB All DBs
Position
8
AA seq 372 aa AA seqDB search
MVKMVGYSVRICKAHFGKRGGHLGIIHYLLIIVFCGSLLAFLFVDVIELWVTALGMSRLE
SPQGVVLPHSVPPTRSEEFLLMPSIHVCERAKPYLITLVATAPPNRKARQAIRDTWGGEV
HVRGHRVMTLFVVGQPTDPVIGKELIEESKERGDLIQGRFTDTYTNLTLKTLSILGWARR
FCPQAHYVAKVDDDVMFNPNALLQYLNLSFKRDESELLELYLGRVHMQVAPDRNPASRHF
MSETAYAGMVLPDYCSGTAYVLSRSALLKLSLAAVAINLPKPLPPEDVFVGICAHTAGIN
PTHSPFFSGGPAVPYSRCCYQTMVSVHHTTPANMLNYWTDMHSSGPCSWLGVRTSLGVCK
VRALLGTLLRRD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaatggtggggtatagtgtcaggatatgcaaagctcacttcgggaagcgagga
ggccatttggggatcatccattacctcctcattatagtcttctgtggctccctgcttgct
ttcctcttcgttgacgtcattgaattatgggtgactgcgctggggatgagccgattggaa
agtcctcaaggggtggttcttccacacagtgttcctccaacccgatctgaggagttcttg
ctgatgcctagcatccacgtgtgcgaacgtgccaaaccctacctcatcactttagtagca
actgcacctcctaatagaaaggctcgccaggcaatccgggacacttggggtggggaagtg
cacgtcagaggtcaccgggtcatgaccctcttcgttgtaggtcaaccaacagacccggtt
attggaaaagagctaatcgaagaatcaaaagagcgcggggatctaatacaaggtcgcttc
actgacacatacaccaatttaacacttaaaacgctgtctatattaggatgggcgcgccgc
ttctgtccacaggcgcactatgttgctaaagtagacgatgatgtgatgttcaacccaaac
gcgctgcttcaatatctcaacctgagctttaaaagagacgagagcgaacttcttgagctt
tatttaggtcgtgttcatatgcaggtcgcacccgatcgcaatcccgccagcagacacttc
atgtcggagactgcatacgctgggatggtcctcccggattactgcagtgggacggcgtat
gtgctttctcgctcagctttgctgaagctgtccctagcagcggttgccataaatctaccc
aaacctttgcccccggaggatgtgtttgtaggcatttgtgctcacaccgcaggaatcaat
ccaacccattctccattcttctctggaggaccggccgtaccgtacagccgctgctgctac
cagacgatggtgtccgtccatcataccacaccagctaatatgttaaactactggacggac
atgcactcctccggcccgtgctcatggttgggtgtgcggacgtctttaggtgtctgtaaa
gtaagggcacttcttgggacactcttgaggagggattaa

DBGET integrated database retrieval system