KEGG   Danio rerio (zebrafish): 30553Help
Entry
30553             CDS       T01004                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    30553 (sod1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     30553 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
10
AA seq 154 aa AA seqDB search
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCIS
AGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVI
HEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaaggccgtttgtgtgcttaaaggcaccggtgaagtgaccggcaccgtctat
ttcaatcaagagggtgaaaagaagccagtgaaggtgactggtgaaattactggccttact
ccaggaaaacatggtttccacgtccatgcttttggtgacaacacaaacggctgcatcagt
gcaggtccgcacttcaaccctcatgacaaaactcatggtgggccaaccgatagtgtgaga
cacgtcggagacctgggtaatgtgaccgctgatgccagtggtgttgcaaaaattgaaatc
gaggatgcaatgctaactttgtcaggccaacattctattattgggaggaccatggtgatt
catgagaaggaggatgacttggggaagggtggcaatgaggaaagtcttaaaactggcaac
gctggcggtcgtctggcctgtggagtgatcggcatcactcagtga

DBGET integrated database retrieval system