KEGG   Danio rerio (zebrafish): 322453Help
Entry
322453            CDS       T01004                                 

Gene name
prss59.1
Definition
(RefSeq) trypsinogen precursor
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16
AA seq 242 aa AA seqDB search
MRSLVFLVLLGAAFALDDDKIVGGYECQPNSQPWQASLNSGYHFCGGSLVSEYWVVSAAH
CYKSRVEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYV
QPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDTMF
CAGYLEGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTMR
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttggtgttcctggtgctccttggagctgcctttgctctggatgatgacaag
attgttggtggatatgagtgtcagcctaattcccagccctggcaggcatctctgaactct
ggctaccacttctgcggtggctctctggtcagcgaatactgggttgtgtctgctgctcac
tgctacaagtcacgtgtggaggtccgtttgggcgaacacaacatcgtcattaatgagggt
actgagcagttcatcacctccgagaaggtcatccgcaaccccaactatgactcgtgggat
cttgacagtgacatcatgctgatcaagctgagcaagcctgccaccctcaacaagtatgtg
cagcctgtggccctgcccaacggctgtgctgctgacggcaccatgtgcagagtctctggc
tggggaaacaccatgagctccactgctgattccaacaagcttcagtgtttggagatcccc
atcctgtctgaccgcgactgtaacaactcctaccccggcatgattaccgacaccatgttc
tgcgctggatacctggagggaggaaaagactcttgtcagggtgactctggtggtccagtg
gtgtgcaacggtgagcttcatggtattgtgtcctggggttatggctgtgctgagaagaat
catcctggtgtttacggcaaggtctgcatgttcagccagtggatcgccgacaccatgaga
aacaactaa

DBGET integrated database retrieval system