KEGG   Danio rerio (zebrafish): 335817Help
Entry
335817            CDS       T01004                                 

Gene name
pkma, cb1029, fj33f03, pkm2, pkm2a, wu:fj33f03
Definition
pyruvate kinase, muscle, a (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    335817 (pkma)
   01230 Biosynthesis of amino acids
    335817 (pkma)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    335817 (pkma)
   00620 Pyruvate metabolism
    335817 (pkma)
  Nucleotide metabolism
   00230 Purine metabolism
    335817 (pkma)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     335817 (pkma)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   335817 (pkma)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
18
AA seq 532 aa AA seqDB search
MSQTKAQDMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVD
TLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEI
RTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDG
LISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDM
IFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGI
EIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCI
MLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEA
SFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSN
DVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPVP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaactaaagctcaggatatgggctctgccttcatccagacgcagcagctcaat
gctgccatggccgacactttcctggagcacatgtgtctgctggacatcgactccgagccc
accatcgctcgcaacactggaatcatctgcaccatcggaccggcctcccgctcagtggac
acactgaaggagatgatcaagtctggcatgaacatcgctcgcatgaacttctctcacggc
tcacacgagtatcatggagaaactattaaaaatgtacgtgaagcttgtgccagctttgag
ccgggcagcatccagtacaggccagtgggcatcgccctcgacaccaaaggaccagaaatc
cgaactgggctcattaaagggagtggcacagctgaggtggagctgaagaagggaaataag
atcaaggtgaccttagatgactccttcatggagaactgtgatgaagataccctctggctg
gactacaagaacatcaccaaggtggtggaggtgggcagtaaagtctacatcgatgacgga
ctcatctctctccaggtgctgcagatcgggtctgactatctgatctgtgagattgagaat
ggaggatctctgggcagtaagaagggtgtgaatctgccgggagccgcagtggatctgcct
gcagtctcagagaaggacatcaaggatctgcagttcggtgtggagatgggagtcgatatg
atcttcgcctccttcatccgcaaggccgctgatgtgcaggcagtccgaaaagtgctggga
gaaaagggcaaaaacatcaagatcatcagcaagctggagaaccatgagggagtgcgcagg
tttgatgagattatggaggccagcgacggcatcatggtggctcgtggtgatctaggaatt
gaaatccccacagaaaaggtgtttctggctcagaagatgatgattggtcgttgcaacaag
gcaggaaagccaatcatctgtgccacacagatgttggagagcatgatcaagaagcctcgt
cctacacgtgcggagggcagtgatgtggccaatgcagttctggacggagccgactgcatt
atgctgagcggagagaccgctaaaggagattatcctctggaggccgtccgcacacagcac
atgattgcccgtgaggcagaggccgccaccttccaccggcagctgtttgagggtctgaga
cgctcctctgttctgacccgtgacccttcagatgcagtcgctgtgggagccgtcgaggct
tccttcaaatgctgcgccagcggcatcatcatactcaccaaaaccggcaggtctgctcat
ctgatctctcggtatcgtcctcgcgctccaatcctagcggtgactcgtaatgaacagaca
gctcgacaggctcatctttaccgtggtattttccccatatactacaacagcccatctaat
gatgtgtgggccgaggacgtggacctgagggtcaacttcgccatggatgtcggtaaagct
cgtggattcttcaaggctggtgatgtggtgatcgttctgactggctggcgtcccggctct
ggatacaccaacaccatgcgtgtcgtcccagtgccgtaa

DBGET integrated database retrieval system