KEGG   Danio rerio (zebrafish): 335817Help
Entry
335817            CDS       T01004                                 

Gene name
pkma, cb1029, fj33f03, pkm2, pkm2a, wu:fj33f03
Definition
pyruvate kinase, muscle, a (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dre00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dre00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
18
AA seq 532 aa AA seqDB search
MSQTKAQDMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVD
TLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEI
RTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDG
LISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDM
IFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGI
EIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCI
MLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEA
SFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSN
DVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPVP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaactaaagctcaggatatgggctctgccttcatccagacgcagcagctcaat
gctgccatggccgacactttcctggagcacatgtgtctgctggacatcgactccgagccc
accatcgctcgcaacactggaatcatctgcaccatcggaccggcctcccgctcagtggac
acactgaaggagatgatcaagtctggcatgaacatcgctcgcatgaacttctctcacggc
tcacacgagtatcatggagaaactattaaaaatgtacgtgaagcttgtgccagctttgag
ccgggcagcatccagtacaggccagtgggcatcgccctcgacaccaaaggaccagaaatc
cgaactgggctcattaaagggagtggcacagctgaggtggagctgaagaagggaaataag
atcaaggtgaccttagatgactccttcatggagaactgtgatgaagataccctctggctg
gactacaagaacatcaccaaggtggtggaggtgggcagtaaagtctacatcgatgacgga
ctcatctctctccaggtgctgcagatcgggtctgactatctgatctgtgagattgagaat
ggaggatctctgggcagtaagaagggtgtgaatctgccgggagccgcagtggatctgcct
gcagtctcagagaaggacatcaaggatctgcagttcggtgtggagatgggagtcgatatg
atcttcgcctccttcatccgcaaggccgctgatgtgcaggcagtccgaaaagtgctggga
gaaaagggcaaaaacatcaagatcatcagcaagctggagaaccatgagggagtgcgcagg
tttgatgagattatggaggccagcgacggcatcatggtggctcgtggtgatctaggaatt
gaaatccccacagaaaaggtgtttctggctcagaagatgatgattggtcgttgcaacaag
gcaggaaagccaatcatctgtgccacacagatgttggagagcatgatcaagaagcctcgt
cctacacgtgcggagggcagtgatgtggccaatgcagttctggacggagccgactgcatt
atgctgagcggagagaccgctaaaggagattatcctctggaggccgtccgcacacagcac
atgattgcccgtgaggcagaggccgccaccttccaccggcagctgtttgagggtctgaga
cgctcctctgttctgacccgtgacccttcagatgcagtcgctgtgggagccgtcgaggct
tccttcaaatgctgcgccagcggcatcatcatactcaccaaaaccggcaggtctgctcat
ctgatctctcggtatcgtcctcgcgctccaatcctagcggtgactcgtaatgaacagaca
gctcgacaggctcatctttaccgtggtattttccccatatactacaacagcccatctaat
gatgtgtgggccgaggacgtggacctgagggtcaacttcgccatggatgtcggtaaagct
cgtggattcttcaaggctggtgatgtggtgatcgttctgactggctggcgtcccggctct
ggatacaccaacaccatgcgtgtcgtcccagtgccgtaa

DBGET integrated database retrieval system