KEGG   Danio rerio (zebrafish): 378968Help
Entry
378968            CDS       T01004                                 

Gene name
abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    378968 (abat)
   00650 Butanoate metabolism
    378968 (abat)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    378968 (abat)
   00280 Valine, leucine and isoleucine degradation
    378968 (abat)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    378968 (abat)
Enzymes [BR:dre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     378968 (abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     378968 (abat)
Amino acid related enzymes [BR:dre01007]
 Aminotransferase (transaminase)
  Class III
   378968 (abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
LinkDB All DBs
Position
3
AA seq 500 aa AA seqDB search
MASSLLTRQLALSLQQNLRLAAPGSRYVSKTATKTVSEFEYDAPSMKTTVPGPKSKELLR
QLGEIQNTGAIHFFCNYEESRGNYLVDVDGNRMLDVYTQISSIPIGYNHPALMKVMTNPN
NVSAFVNRPALGILPPENFPEKLAESLLSIAPSGMTKVQTMACGSCSNENAFKSMFIWYR
NKERGYATPSEEEVGTCMVNQSPGCPDLSILSFMGAFHGRTLGCLATTHSKAIHKLDIPS
FDWPIAPFPKLRYPLEEFERENAQEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGG
DNHASPDFFIKLRNIARKHGCGFHVDEVQTGGGATGKFWAHEHWGLDDPADLVSFSKKML
TGGYFHRDELQPDKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEQVTRSGKALLQGLY
ALQSQYPHLLSGARGQGTFCAINASSDATRDSIMLKARNKGVFLGSCGEKSIRFRPALVF
KEYHVHQLLNILNDVLAEHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcactcctgacccgtcagctggctctttccctccagcaaaacctgcgtctc
gctgctccaggttccagatatgtcagcaaaactgctacaaagactgtttcagagtttgaa
tatgatgccccatccatgaagactactgtgcccggtccaaagtccaaggagctgctgaga
caacttggagagattcagaacactggagctattcactttttctgcaactatgaggagagc
agagggaattacctggtggacgttgacggaaaccgaatgctggacgtgtacacacaaatc
tcctccattcccatcggttacaatcatccagccttaatgaaagtgatgaccaatccaaat
aatgtgagtgcatttgtcaaccggccggcacttggtatcctgccacctgagaactttcca
gagaaactggcggagagcctgttgtcgatcgcccccagcgggatgacaaaagtgcaaacc
atggcttgtggctcctgctccaatgagaatgctttcaagagcatgtttatctggtacaga
aataaagaaagaggatatgcaaccccctccgaagaggaagtcggcacttgcatggtcaat
cagagtcctggatgtccagatttgagcattttgtctttcatgggagctttccatgggagg
actttgggttgcctggccacaacacattccaaggccatccacaagctggacatcccatcc
ttcgactggcctatcgcacccttcccgaagctgcggtatcctctggaggagtttgagagg
gagaatgctcaggaggaagcccgctgtctggaggaggttgaggatctgatagtgaagtgg
aggcagaagggcaaaccggtggctggtattgtgatcgagcccatccaagctgaaggagga
gacaatcacgcctcaccagacttcttcatcaaactaagaaacattgcacgcaagcatggc
tgtggtttccacgttgatgaggttcagaccggtggaggagcaacgggcaaattctgggct
catgagcactggggtctggacgaccctgcggatttggtgtccttcagcaagaagatgctg
accggaggatattttcacagagatgaactgcagcctgacaaaccttacagaatcttcaac
acgtggatgggagacccttccaagaatctgttcctatcagaggtgctcaatgtgatcagg
agagagaaccttctggagcaggtgacgcgttcaggcaaagctcttctgcaggggctctat
gctctacagagtcagtatcctcatctcttgagcggagcccgtggtcagggaacattctgt
gccatcaacgccagcagtgatgccacacgtgactccatcatgctgaaggccaggaacaag
ggtgtatttctgggttcctgtggagaaaaatccatccgtttccgtcctgctctagtcttc
aaggagtatcatgtccatcagctgctgaacatcctgaatgacgtcctggctgagcataaa
tag

DBGET integrated database retrieval system