KEGG   Danio rerio (zebrafish): 393789Help
Entry
393789            CDS       T01004                                 

Gene name
hdac9b
Definition
(RefSeq) histone deacetylase 9-B
  KO
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     393789 (hdac9b)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     393789 (hdac9b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16
AA seq 582 aa AA seqDB search
MHNVNNSVDIKPEVPLALDPGSPLDLRTDIRMQGSASEVTVWERQLQQELLLIQKQQQIQ
KQLLITEFQKQHENLVRQHQAQIQEHLKLQQELHVMKQQQEQLEKERKLELQSQERELER
HRREQQVLVLRNRERTRESLTGAVASNEVKQKLQEFLLSKSTKDITLNGIPQKITQSSKL
WYTASHHTSLEQSSPPLGGASSSCKISLPSPQDYRDDFPLRKTVSEPNLKVRSRLKQKVA
ERRSSPLLRRKEGNIMTPFKKRALELLESTASSSAPGSGPSSPNGACSALGAENGPSSLP
VTTRTERWPSQSRLLGPESSVSMLNLYTSPSLPNISLGFSAASSPISAALGLQEKHVDNG
AVSAVIQGLPTQLLGPVPLSVMETKVSSSHQALLQHLLQKEQLRHQKILSSGQSPVHPPS
PLAMMENSPSSTRPKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQNFLEKQKQYQQQVHI
NKMLSKSIEQLRQPNVHLQESEEEEGEDCQEHAMQEESSPSGGVIRKHSPQNTSRSPTIP
LDSHPGVIRVKEEPGASDDETMANQSSYIHQVKGRMVIQAMI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacgtcaacaactcagtggacattaagccagaggtaccactggctcttgatcca
ggctctccactggatcttcgtacagacattaggatgcagggctctgcttcagaagtcact
gtctgggaaagacaacttcaacaagaactgctcctcattcagaaacagcagcagattcag
aagcagttactcatcactgagtttcagaagcagcacgaaaacctggttcgccagcatcag
gcccaaatacaggagcacctgaagttgcagcaggaacttcacgtcatgaagcaacaacag
gagcagctggagaaagaacggaaactagagctccagagtcaggagagagaactggagaga
catcggcgcgaacaacaagtgctggttctgcggaacagagagcggaccagagagagcctg
acaggtgcagtggccagcaatgaggtcaagcagaaactccaggagtttctgttgagtaaa
tccaccaaagacattacattgaatgggatccctcagaaaatcacgcagagctctaaactc
tggtacacggcctcccatcacacctctctagagcaaagttcacctcctttgggaggtgcg
tcctcctcttgcaagatctccctgccctccccacaggactaccgggacgactttcctctg
aggaagacagtgtccgagcccaatctgaaggtgcgctccaggttaaagcagaaggttgcg
gagaggaggagcagtccacttctacggaggaaagagggcaatatcatgacacccttcaaa
aagagagcattggagctgttggaatccaccgccagcagcagcgctccaggatcagggccc
agttctcccaacggggcctgcagtgccttgggggctgaaaacggaccctcttcactacca
gtcaccacacggactgagcggtggccgtcacagtcgaggttattagggcctgaaagctca
gtgtctatgttaaatctctatacgtctccatcgctgcccaatatctctctcggtttctcg
gctgcctcttctcccatcagcgctgctttaggtcttcaggagaagcatgttgataatggt
gccgtatcagcggtcattcaaggattgccaacccaacttctgggtccagttccattgtct
gttatggagaccaaagtgagcagcagccaccaagctctcctgcagcacctcctccagaag
gagcaactccggcaccaaaagatcctctcttctggtcaaagtcctgtgcatccaccctct
ccgctggccatgatggaaaactctccaagcagcacccgacccaaactgcctcgtcaccgg
cccctgaatcgcacccagtcggctccgctgccccagagcacattagctcaacttgtgatt
cagcagcaacatcagaacttcttggagaagcagaaacagtaccagcaacaggtccacatc
aacaagatgctttccaaatccatcgagcagctccgtcagccaaatgtccacctgcaggag
tcagaggaggaagaaggagaagactgtcaggaacatgccatgcaggaggagagctcgccc
tctggtggcgtcatccggaagcacagcccccaaaacacctcccgctcacccaccatccca
ctggactctcaccctggcgttatccgggtcaaagaggagcccggcgccagcgatgacgag
acaatggccaatcagagctcctacattcaccaggttaaaggcaggatggtgatccaggcc
atgatatga

DBGET integrated database retrieval system