KEGG   Danio rerio (zebrafish): 559020Help
Entry
559020            CDS       T01004                                 

Gene name
ptgs2b
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00590  Arachidonic acid metabolism
dre01100  Metabolic pathways
dre04370  VEGF signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    559020 (ptgs2b)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    559020 (ptgs2b)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    559020 (ptgs2b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     559020 (ptgs2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 559020
NCBI-ProteinID: NP_001020675
ZFIN: ZDB-GENE-041014-323
Ensembl: ENSDARG00000010276
Vega: OTTDARG00000006192
UniProt: Q5RI06
LinkDB All DBs
Position
20
AA seq 606 aa AA seqDB search
MKSSVLFIFLLLGFVVCTGANPCCSHPCQNRGVCTEMGSDAYECDCTRTGYYGQNCTTPE
FLTWVKVSLKPSPNTVHYILTHFKSLWNIINNVSFLRNGIMRYVLTSRAHLIDSPPTFNA
DYGYKSWEAYSNLSYYTRTLPPVPRDCPTPMGVAGKKELPDVKMLAEKLLLRRKFIPDPQ
RTNLMFAFFAQHFTHQFFKSDMKKGPAFTTALNHGVDLAHIYGQNLDRQHKLRLFKDGKL
RYQILDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAFGLVPGLMMYATIWLREHNRV
CDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFNERFQ
YQNRISSEFNTLYHWHPLMPDDFHIQDEVYNYQQFLFNTSILTDYGVNSLVESFNKQIAG
RVAGGRNVAPAVLRVAIKSIENSRQMRYQSINAYRKRFNMKPYRSFEEMTGEKEMAAELE
EMYGDVDAVELYAGLLVEKPRSNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNSASLQNLVCNNVNGPCPMASFYVPNVKDSLPTTINASTSQSDRNVNPTVLLK
ERTSEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttcggtattatttatttttttgcttctgggcttcgtggtttgcacaggagcg
aacccttgttgctcccatccctgtcagaatcgaggtgtctgtacggaaatgggctccgac
gcgtatgaatgtgactgtacacggactggatattacggtcaaaactgcacaacacccgag
tttctcacatgggtgaaagtctctctgaagccttctcccaacactgtgcattacattctc
acacacttcaaaagcttgtggaatattatcaacaacgtgtcgtttctgagaaacggcata
atgcgatacgtgctgacatcacgtgcccatctgatcgatagtcctcctacattcaatgct
gactatggttacaaaagctgggaagcctactctaatctctcctactatactcgcacatta
cctcctgtcccgcgtgattgcccaacgccaatgggagtcgcaggtaagaaagagctgcca
gacgtgaagatgctggcagagaaactgcttcttaggaggaagttcatcccagatcctcaa
cgcaccaatcttatgttcgctttcttcgcccaacattttactcaccagttcttcaaatct
gacatgaagaaaggtccagctttcacaacagccctgaaccatggggttgatttagctcat
atatatggacaaaaccttgatcgacaacacaagttgagacttttcaaggatggcaagttg
agatatcagattctggatggtgaggtttaccctccaacagtcagtgaggttcaagtagac
atgcattaccctcctcatgtacctgaatctcgtcgatttgctgtgggtcatgaggccttt
gggctggttcccggacttatgatgtacgccaccatctggctgcgtgaacataaccgagtg
tgcgacatactaaagcaggagcatcctgactgggatgatgagaggctgtttcagacctca
aggctcatccttattggtgagactattaagatcgtgatcgaagattacgtccagcacctt
agtggatactattttaagctcaagtttgatcccgaactactcttcaatgagcgtttccaa
taccagaacaggatctcctctgagttcaacacactttaccattggcaccccctcatgcct
gatgattttcacatccaggatgaagtctacaattatcagcagtttctcttcaacacttct
atcctgacagattatggcgtcaacagcttggttgagtccttcaacaaacagatagccgga
agggtagctggagggcgtaatgtagcaccagcagtgttaagggtggccattaagtcgatt
gaaaacagcaggcaaatgcgctaccaatcaatcaatgcttacaggaaacgcttcaacatg
aagccatacagatcctttgaagaaatgacaggagaaaaagaaatggctgctgaacttgaa
gagatgtacggagatgtggatgctgtggagctttatgctggtttgctggttgaaaagccc
aggtccaacgccatctttggggagaccatggttgagatgggtgcgccctactcccttaaa
ggacttatgggaaatcccatctgttccccagagtactggaaaccaagcacctttggtggg
aaagtgggctttgagattgtgaacagtgcctctctgcagaacttggtttgcaataatgtc
aacgggccatgtcctatggcgtccttttatgtgcctaatgtaaaagattcattacccacc
actattaatgcaagtacgtcccagtcagatcgaaatgtcaacccaactgttttactaaaa
gaaaggacatctgagctctga

DBGET integrated database retrieval system