KEGG   Danio rerio (zebrafish): 565980Help
Entry
565980            CDS       T01004                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     565980 (ace)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M2
   565980 (ace)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   565980 (ace)
CD molecules [BR:dre04090]
 Proteins
  565980 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
LinkDB All DBs
Position
12
AA seq 1324 aa AA seqDB search
MNRGKRESRTPIGKQEHPAVNVSRRLLRKLLSQHSASQLRSIMLRAVVLLTLISWSAALK
PEWMPGDYPPTEQGAERFVSDYNSTAEEVLYLSTEASWNYNTNLTDHNSQLQIEASLEEQ
AFTEAWGHKAKATFSESLMDTFTNPDLKKIIKKINVLEAANLAITDRELYNTILSQMDSI
YSTAKVCPSPEECWSLEPELQEIMATSRSYKRLLYAWEGWHNSSGVPLKSLYAEFVKISN
KASQMDGFKDTGEYWRSWYESPTFKQDLENLFKQLEPLYQNLHAFVRRKLYDYYGPKYIN
LKGPIPAHLLGNMWSQTWNNIYNMMIPFPNRPNVDVTNTMIAKGYNATHMFRVAEEFFTS
LGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEM
GHVEYYLQYKDQPVSFRRGANPGFHEAIGDVLSLSVSTPKHLHSIDLLDQLTDDAESDIN
YLLKMALEKIAFLPFGYLIDQWRWSVFSGETPPDRYNADWWYLRTKYQGICPPTRRTEEH
FDAGGKYHIPGNTPYIRYFVSFILQFQFHEKLCKEAGHTGPLHKCDIYKSREAGAVLEKV
LKAGSSEPWTQVLQEALGTDKMDATPLMSYFLPVTTWLREQNEKTGETLGWPDFNWVPPI
PEGYPEDIGKITDEMQAKQFLDEYNSTAEEVWNAYTESSWTYNTDITEAHKDNMLQKNLE
MANHTKIYGLEARKYDTSDFQDESVKRILSKLSDLERAALSAEDLVEYNNLLASMETLYS
VATVCKDKSNCLPLDPDLNKIMAESRDYDELLFAWQGWRNASGREIRDSYKRYVELANSA
AKSNGHTDNGAFWRSLYETPTFEQDLEALWKDLEPLYLSVHAYVRRALYKKYGPERINLK
GPIPAHLLGNMWAQTWSGIMDLVNPYPDATQVDATPAMIAQGWTPKRMFEESDRFFTSLG
LLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGH
VQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPKHLQSIGLLDKVEDNAESTINFL
MSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPVPRTEKDFD
PGAKFHIPANVPYIRYFVSFVIQFQFHKGLCDAAGHKGPLHNCDIYQSKEAGKLLSDVMK
MGFSKPWPEAMKIITGQPKMSVQPLMEYFKPLIEWLEKENEKNGDVLGWPEYDWTPYKLS
TVVEESPKSVNFLGLSVDAAGAAAGQWILLVLSIVFLLAVVFLAYRYSKTKRLQNKSMSQ
MELK
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagggaaaagggagagcaggacaccgataggaaagcaggagcatccagcagtg
aacgtgtccagacggctcctccggaaacttttaagccagcactcggcgtctcagctgcgg
tccattatgctgcgtgcggtggtgctgctgactctcatcagctggagcgcggctctgaaa
cccgagtggatgccaggggattatcctccaactgaacaaggggcagagaggtttgtgagc
gactacaactccaccgccgaggaggtgctttaccttagcacagaggccagctggaactac
aacacaaacctgaccgatcacaattcacaactgcagatagaagcatctttggaggagcag
gcttttacagaggcatggggtcacaaagcaaaggctaccttcagtgaatctctaatggac
accttcactaatccagacctgaagaagatcatcaaaaagatcaatgtcctggaagccgcc
aatctcgcaatcacagacagagagctgtacaacactattctgagccagatggacagcatc
tactccactgcaaaggtgtgtccctctccagaggaatgctggtctttggagcctgagctc
caagaaatcatggctacctcaagaagctataagaggctcctgtatgcctgggaaggctgg
cataattcctcaggtgttcctcttaaatctctttacgctgagtttgtaaagatcagcaac
aaggcatctcaaatggacggctttaaagacacaggcgagtactggcgctcttggtacgag
tctcctaccttcaagcaagaccttgagaacctgtttaaacagctggaacctctctaccaa
aacctgcacgcttttgtccgccgaaagctctacgactactatggtccgaaatacatcaac
cttaaaggtcccatccctgctcatctattgggcaacatgtggtcacaaacatggaacaac
atctacaatatgatgatccctttccctaacagacccaatgtagatgtgaccaataccatg
atcgctaaaggttataatgcaacgcacatgttccgggtagcagaggagtttttcacctct
ttgggtttgctggaaatgcctcctgagttttgggacaagtccatgctggagaaacccact
gatggaagagaggtggtgtgtcatgcttctgcctgggacttttacaaccgcaaagacttc
agaatcaagcagtgcacgactgtgaccatggaacagctgttcacagtgcatcatgagatg
gggcatgtggaatattacctccagtacaaagatcagccagtgagcttcagaagaggagcc
aatcctggcttccatgaggccatcggggacgttctctctctttctgtgtccactcccaaa
catctccacagcattgacctcctggaccaactaaccgatgacgctgagagtgacatcaat
tacctgttgaagatggccttggaaaagatcgccttccttccttttgggtaccttattgac
cagtggcgatggagtgtgttcagtggagagacaccgcctgaccgctacaatgcagattgg
tggtacctcagaacaaaataccaaggcatctgtccaccaaccagacgtacagaagagcat
tttgatgctggagggaaatatcacatccctggaaatacaccgtacataagatactttgtg
agcttcattctgcagttccagttccatgagaaattatgcaaagaggctggacatactgga
cctctgcacaaatgtgacatctacaaatcacgtgaagctggagctgttctagagaaagtc
ttgaaggctggctcttcagaaccttggactcaggtgctacaagaggcgctgggcactgac
aaaatggacgccacccccctgatgagctattttctgccagttaccacctggctgagggaa
cagaatgagaaaaccggcgagacgcttggctggcctgattttaactgggtgccaccaata
ccagagggctaccctgaagacattggtaaaataacagacgagatgcaggccaagcagttt
ttagatgaatacaacagcacagccgaggaggtctggaacgcttacaccgagtcctcctgg
acctacaacactgacatcaccgaagcccacaaggacaacatgctgcaaaaaaacttggag
atggccaatcacaccaagatctatggactagaggcccgtaaatacgacaccagtgacttc
caggacgagtctgtgaagaggatcctgagcaaactgagtgatctcgagagggctgcgctt
tctgcagaagatctcgtggagtacaataatttactagcatccatggagaccctgtacagt
gtagcgacggtctgcaaggacaaatcaaactgtctgcctctggatccagatctgaataag
atcatggctgagtcgcgggattatgacgagctgctgtttgcctggcagggttggcgaaac
gcctctggcagagaaatccgagacagctacaagagatatgtggagctcgccaactccgct
gctaaaagcaatggtcacactgataacggagcattctggcgctctctgtatgagactccc
acctttgaacaggatctggaggccttgtggaaagatctagaaccgctctacctcagcgtt
catgcttatgtgcgcagggcactgtacaagaaatatggaccagaacgcatcaacctgaaa
gggccgattcctgcacatctgcttggaaacatgtgggctcaaacatggtctggtatcatg
gatctcgtcaatccgtaccctgatgccacacaagtggatgccacgccagccatgatcgca
caaggctggacccccaagcgtatgtttgaggaatctgacaggtttttcacatctctgggt
ctcctgcccatgcctcctgagttctggaacaagtccatgctggaaaagccaacagatggc
cgtgaagtggtgtgccatgcctctgcctgggacttctacaaccgcaaagactttaggatc
aagcagtgcacggtggtgaccatggatgacctcattactgtgcaccacgagatgggccac
gttcagtacttcctgcagtataaggatcagcccatctctttccgtgacggcgccaaccct
ggtttccacgaggccatcggtgacgtactagctctgtcagtagccacacctaaacatctt
cagagcatcggcctgctggacaaggtggaggacaatgcagagagcaccatcaactttctg
atgagcattgcattggataagattgccttcttgccatttggatacctgatggaccagtgg
aggtggaaagtgtttgatggaaggatctcaagctcagaatacaacaaagagtggtggaac
ctgagaatgaagtatcagggattgtgtccacccgtcccgcgcactgagaaagacttcgac
cctggcgcaaagttccacatcccagcaaatgtgccctacatcaggtactttgtgagtttt
gtaatccagttccagttccacaaaggcctgtgtgatgctgcgggtcacaaagggccgctc
cacaactgtgacatctaccagtccaaagaagcaggaaaactcctgagtgatgtgatgaag
atgggcttcagtaaaccctggcctgaagccatgaagatcatcacaggtcagcccaaaatg
tccgtccagcctctgatggagtatttcaaaccgctcatcgagtggctggagaaggagaac
gagaagaatggcgacgtgctgggatggccagagtacgactggacaccttacaaactcagc
acagtggtggaggagtcgcccaaatctgtgaatttcctggggttgagtgtggatgcagcg
ggagcagcagcgggacagtggatcctgctggtcctcagcatcgtcttcctgcttgccgtc
gtcttcttagcctacagatacagcaagactaaacgcctacagaacaaatccatgtctcag
atggagctcaagtaa

DBGET integrated database retrieval system