KEGG   Danio rerio (zebrafish): 566581Help
Entry
566581            CDS       T01004                                 

Gene name
tgm1l1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     566581 (tgm1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core DUF1391
Motif
Other DBs
NCBI-GeneID: 566581
NCBI-ProteinID: XP_694950
ZFIN: ZDB-GENE-060503-139
Ensembl: ENSDARG00000102106
Vega: OTTDARG00000018074
LinkDB All DBs
Position
2
AA seq 783 aa AA seqDB search
MPGERQSIRDNSAVGRFHGVSARNGEAVAEKPSESKTKKPESGCRRWLRKACPCCLRRQS
NSYDLTSEADGVVAGNEEIEQPASPVSVSVETNVDDLSLVVRSVDLLSRKTDRNKKEHHT
DQYSGDQLIIRRGQTFQIELELSRPFNPNTDKLHLELKTGALPLVSKGTHIIIPLVEELQ
DERWEAKIVEQNLNRAKLSINSSVNAVIGKYTLTVVTQCLKTNESTTHDPEKDIYMLFNP
WCEDDAVFMEGERELNEYVLNDTGRIYYGTEKQIGARTWNFGQFDEGILEACLFVLDNSE
VPPSGRGDPVNVVRVISAMINSPDDRGVLEGNWSGNYTGGTSPTAWSGSVEILKQYHREG
GTPVKYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDEDMEPIHHLN
SDSVWNFHVWNDCWLARPDLPPGFGGWQAVDSTPQETSHGTFRCGPASLAAVRSGQVYLK
YDVPFVFAEVNSDKIYWQRNLDGTFSQIHSEKKAVGHCISTKAVGSDERVDITDVYKYPE
GSEEERIAVETACRYGSKPDVYSSAMAEDVQVEVRMEGEGPRMGGDAQLKIVVKNMSSQP
RRTTLHSQAAVMYYTGVLKDTVKKDKLSVELMPQEEKVIEWTLPYTQYQNQLVDQAALML
TLSGRVSETQQVLANQTSFRLRTPDLQIEPIGEAYVGKEASAKISFTNPLPCTLRNVVVR
VEGLGLRDLHPIKVGDVGKHGKVMVTEHFIPSIAGERKLVASLDCKQLTQVHGVADIIVH
ESQ
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagaaagacagtcaattcgagataactctgctgtcggccgattccacggcgtt
tcagcaaggaatggagaagccgtcgcggagaaacccagcgagagtaaaacgaagaaaccg
gagagcggctgcaggcgctggctacgaaaggcttgtccatgctgcttacgccgacagagc
aactcttatgatttaaccagtgaagcggatggtgtggttgctggaaatgaagaaatcgaa
cagccggcgtctccagtgtctgtcagtgtagaaaccaatgtggacgatttgtctctagtg
gtgcgatctgtggatctgctcagccggaaaactgaccgtaataagaaggagcatcacacg
gatcagtacagtggagatcagctgatcatccgcagaggacagactttccagattgagctg
gagctctcacgacccttcaacccaaacaccgataaactacacctggagctgaagacagga
gcgctcccactggtgtccaaagggacgcacatcatcatcccactggtggaggagctacag
gatgaacgctgggaggccaagattgtggagcagaacctcaaccgggccaagctgtccatc
aactcatccgtcaatgctgttataggaaaatacacgctgactgtcgtaacccagtgtcta
aagacgaacgaatctaccacacacgatcctgaaaaagacatttacatgctcttcaatccc
tggtgtgaagatgatgctgtgttcatggagggagagagagagctgaatgagtacgtcctc
aatgacaccggcaggatctactacggcacagagaagcagatcggagctcggacatggaac
ttcggtcagtttgatgaagggattctggaggcctgtctgtttgtgctggataacagtgaa
gttcctccatcaggaagaggagatccggttaatgttgtccgggtcatttctgccatgatc
aactctccggatgaccgtggtgttctggagggaaactggtctgggaattacactggagga
acgtctcccaccgcatggagtggaagtgttgaaattctcaagcaataccacagagaagga
ggaacgccggtcaaatacggacagtgctgggtgttctctggagtcacaaccacagtgttg
agatgtcttggtattcctgcccggtccgtaacaaacttccagtctgcccacgatacggat
gtgtccttgaccacagatgtgtattttgatgaggatatggagccgatccatcatctcaac
tctgactccgtatggaacttccatgtgtggaatgactgctggttggcacgtccggatctg
cctcctggttttggcgggtggcaggcggtggactccacacctcaggagaccagtcatggg
acgtttcgctgcggtccggcgtctctggctgcggttcgctctggacaggtctatctcaaa
tacgacgtgccgttcgtcttcgctgaggtgaacagtgacaagatctactggcagagaaac
ctggacggcaccttcagtcagatccacagtgagaagaaggctgtgggtcactgcatcagc
actaaagctgtgggctccgatgaacgagtcgacatcacagacgtctacaaataccctgaa
ggctcagaggaggagcgtatcgcggtggaaacggcctgtcggtatggcagtaagccggat
gtgtactcgagcgccatggcggaggacgtgcaggtggaggtgcggatggagggagaaggt
cctcgtatgggtggagatgctcagttgaagattgtggtgaagaacatgagctctcagcca
cgcagaaccacccttcacagccaggcggcagtcatgtactacaccggcgtgctgaaggac
accgtgaagaaggacaagctcagtgtggagctcatgccacaggaagaaaaggtcatcgag
tggaccctgccttacacacagtaccagaatcagctggtggatcaggctgcgctcatgctg
actctgtctggaagggtcagtgagacccagcaggttctggccaaccagacatcctttagg
ctccgcacacctgacctccagattgagcccatcggagaggcgtatgtgggtaaagaggcg
tctgccaagatcagcttcaccaatcctctgccctgcactctgcgtaatgtggttgtccga
gtggaaggactggggctccgagacctgcatcccatcaaagtcggtgatgtgggcaagcat
ggtaaagtaatggtgacggagcacttcatcccatctatagctggcgagaggaagctggtg
gcgtcactggactgtaaacagctgacgcaggttcacggtgtggccgatatcatcgttcac
gaaagccagtga

DBGET integrated database retrieval system