KEGG   Danio rerio (zebrafish): 568877Help
Entry
568877            CDS       T01004                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    568877 (hdac4)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     568877 (hdac4)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     568877 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 568877
NCBI-ProteinID: NP_001034447
ZFIN: ZDB-GENE-061013-95
Ensembl: ENSDARG00000098349
Vega: OTTDARG00000025076
UniProt: Q08BS8
LinkDB All DBs
Position
9
AA seq 1023 aa AA seqDB search
MVDVSVALPLQVPPSAIPMDLRVDHQFALAPTDPAQREHQLQQELLALKQKQQIQRQLLI
EEFQRQHEQLSRQHEAQLQEHVKHQQDLLALKHQQELLEHQRKLGRHRQEQEMEKQQREQ
KLQLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNHCLPSDPRYWYGKTQHSS
LDQSSPPQTGISTYNHPVLGMYDPKDDFPLRKTASEPNLKLRSRLKQKVSERRSSPLLRR
KDGPITTAKKRSLDMAESACSSAPGSGPSSPNNSSNNITNENGIAGSISNSAVEPSLAHR
LTGREGPVSQLSLYTSPSLPNITLGLPATGPSSVASGQQDGDRMAVPGLQPGIPITTPFM
PGAHLPSYLAASSLERESGSAHNTLLQHMVLLEQSAAQNSLVAGLSGVPLQSHSIHKLRQ
HRPLGRTQSAPLPQNSQALQQLVVQQQHQQFLEKHKQQFQQQQLHISKMMVKPSEPNRQH
ESHPEETEEELREHQGLGDPADPLPHGVTIKQEPPDEQDEDFQQRERQAEEELLFRQQAL
LLEQQRIHQLRNYQASMEAAGLSVSFPVHRPLSRAQSSPASATFPIVVQEPPAKPRFTTG
LVYDTLMQKHQCMCGNSNIHPEHAGRIQSIWSRLQETGLRGQCECIRGRKATLEELQTVH
SEAHVLLYGTNPLRQKLDSSVTPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVDL
VFKVASGELRNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDV
HHGNGTQQAFYSDPNVLYLSLHRYDDGNFFPGSGAPDEVGIGPGVGFNVNMAFTGGLEPP
MGDADYLAAFRSVVMPIANEFSPDVVLVSSGFDAVEGHPPPLGGYKLTAKCFGYLTKQLM
GLAGGRLVLALEGGHDLTAICDASEACVSALLGNELDPIPEDILQQRPNANAIQSMEKVL
EVQSKYWRSLQRSVSTLGYSLREAQRCENEEAETVTAMASLSVANKHMGKRPEEEPMEEE
PPL
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtgagtgtggcgctgccactgcaagtgccaccttctgccatccctatggac
ctgcgtgtggatcaccagttcgccctggcgccgacagacccggcccagcgtgagcatcag
ctgcagcaggagcttctggccctcaagcagaaacagcagatccagaggcagctcctgatc
gaagagtttcagcggcagcacgagcagctctcccgacagcatgaagcccagctgcaggag
catgtcaagcatcagcaagatctgttggctttgaagcatcagcaggagctcctggaacac
cagcgcaagttggggcgtcatcgacaggagcaggagatggagaaacagcagcgagaacag
aagctacagttactcaaaaacaaagagcgcggacaagagagcgccgtggcgagcactgag
gtcaagatgaggttgcaggagttcgtcctcaataagaagaaagcgctggcccagaggagt
ctcaaccactgcctgcccagcgacccacgctactggtacgggaaaacccagcacagctct
ctggaccagagctcaccacctcagacagggatttccacttacaaccacccggtgctggga
atgtacgaccccaaagatgacttcccgctccgcaagacggcatctgagcccaatctaaag
ctgcggtccaggctgaagcagaaggtcagcgagcgcaggagcagccctctgctaaggagg
aaggacggacccatcaccactgcaaagaaacgctctctggacatggcagagtcggcatgc
agcagtgctcctggttctggcccgagttcacccaacaacagctcaaacaacattaccaat
gagaacggcatcgctggatcaatctccaacagcgcagtggagccatcgttggcacacaga
ctcacgggcagagagggtcctgttagccagctgtctctgtacacatcgccctcccttcca
aacatcaccctgggtctgccagccaccggcccctccagcgtggcatcaggccagcaggat
ggtgacaggatggcagtgccaggcttacagccaggaatccccataaccactccgttcatg
ccaggagcccacctgccgtcatacctggccgcctccagcttggagcgggaaagcggctcg
gctcacaacactctcctccagcatatggtgcttctggagcagtcggccgctcagaactcc
ctggtcgcaggtctgtcaggtgttcccctgcagtctcattccatccacaagctccggcag
catcggcctctcggacgcacccagtcggcgccgctgccccagaactcccaggctctgcag
cagctggtggttcagcagcagcaccagcagttcctggagaaacacaagcagcagttccag
cagcagcagctccacatcagcaagatgatggtgaaaccgagcgagccgaaccgacagcac
gagagccacccggaggagacagaagaggagctgagggagcaccaggggctgggagacccc
gcagaccctcttcctcacggggtcaccattaaacaagagcctccagatgagcaggacgaa
gactttcagcagagagagagacaagcggaggaggagctgctcttcagacagcaagctctc
ctattggagcagcagagaattcatcagctgaggaactatcaggcgtccatggaggcggcc
ggactgtccgtgtcttttccagtccatcggcctctttccagagcacaatcatccccggcc
tctgccacatttcccatcgtggtgcaggaacctccggccaaaccacgctttactaccggt
ctggtgtacgacacactgatgcagaaacaccagtgcatgtgtggaaacagtaacatccac
ccggagcacgccggacgcatccagagcatctggtcacgactgcaggaaactggcctgcgt
ggacagtgtgagtgtattcgaggcaggaaagccactctggaagagctccagacagtccac
tctgaggcccatgtgctgctttatggaaccaaccctctcagacagaaactggacagttct
gtgacacccatgttcgtgagactgccttgcggaggaatcggggttgacagcgacacaatc
tggaatgaagttcactcatccagtgctgctcgtctggctgtgggttcagtggtggatctg
gtgtttaaagtggcatcaggagagctgaggaacggttttgctgttgtgcggcctccagga
catcacgctgaagaaagcactcccatgggattttgctatttcaactcggtcgccatcgca
gccaaactcctgcagcagagactcaacgtcagcaagattctcatcgtggactgggatgtt
catcatggaaatgggacgcagcaggccttttacagtgaccccaatgtgctgtatctgtct
ctccatcgctatgatgatggaaacttcttccctggcagcggagctcctgatgaggtgggc
atcggtccaggtgtgggctttaatgtcaacatggccttcactggaggtctggagccacca
atgggggatgcagattatctggcagcattcaggtcggtggtgatgccgatagcgaatgag
ttttctccagacgtggtgctggtttcctcaggcttcgacgctgtggaggggcatccgcca
cctctgggaggatacaagctcacggccaaatgttttggctatctgaccaagcagctgatg
ggactggccggtggtcggctggtgctggcgctggaaggaggtcacgacctcaccgccatt
tgcgatgcctctgaagcatgtgtttctgctttgcttggaaacgagttggaccctattccc
gaagacatcctacagcagagaccgaacgccaacgccattcaatccatggagaaagttttg
gaagtccagagtaaatactggcgttcactgcagcggtcagtctcgactctgggttactct
ctccgtgaggctcagagatgtgaaaatgaagaggcagagacggtcaccgccatggcctcg
ctgtctgtggccaacaagcacatggggaagaggcctgaggaggagcccatggaagaggag
cctccattgtag

DBGET integrated database retrieval system