KEGG   Danio rerio (zebrafish): 569525Help
Entry
569525            CDS       T01004                                 

Gene name
lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    569525 (lig4)
Enzymes [BR:dre01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     569525 (lig4)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     569525 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 909 aa AA seqDB search
MESVSKSDAKPQAFVAAQVPFIHLCTVLEKIQKTKLRPDKSKILKEFIDSWRNFHAALHK
DNPDTADSFYAAMRLIVPSFERERMAYGIKENMLAKLYIEVLGLPKNGDEANKLLNYRAP
TTSQGEAGDFALMAYFVLKKRCTSQGNLSIKEVNDFLGSVATNNASKQKDQVKKSLLHLI
TQSSALEQKWLIRMILKDMKLGISKETVLQVFHPDAPEFYNVTTDLNKVCRQLHDPSVSL
SEVSIDLFSAFKPMLAAVANIRQIEKQMGNRPFYIETKLDGERIQLHKAGDVYKYYTRNS
YEYTQQFGASPLEGSLTPYIHTVFSPHVVNCILDGEMMAYNPKTETFMQKGSKFDIKRLV
DDSDLQTCFCVFDVLLINNQKFGKEPLKKRYESLETVFSPIKGRIHLVSKSEGRTMQEVV
NSLNEAIDNREEGIMVKDPMSIYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGKGR
RSGMLSHFLCAVAEVPSPGEKPTVFHTLCRIGSGYTLKELYDLGVKLAKHWKVYNKNNPP
AAILCGTEKPEVYIEPRNSVILQVKAAEIVTSEMYKTDCTLRFPRIERIREDKEWHQCMT
LDDLNQFRSKASGKLASRHLNIHEDQPEKKKRKIVAKPKKTIGVIDHFKSQDLSKVAKET
DMFEEVEFCVINGDDEHSKAELEKGVARCGGIVVQNPGKDTYCAIAAVQNMRVKNLISSD
QHDVVWATWLLECLENKQVIPWQPRHMIHMSPSTREHFAKEYDQYGDSYYVDTSEQQLRD
VIERISSAEVKSLSVAQIEAENAWDDLPTSIFRPYSAYFDRCADIGDPKSVICGTCLDTR
ALEFRFHGGKVVEKLKEGISHVVVEDMKRALDLKTLRRLHAKKFKIVHESWVTDSIKAGH
VKDEIDYLI
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgtctcaaaaagtgatgccaaaccacaggcatttgttgctgcgcaagttccg
ttcattcacctctgcacagttttggagaaaattcagaagactaaactccgaccagacaaa
agcaaaatcctaaaggaatttatagattcatggaggaatttccatgcagcacttcacaag
gacaacccggacacagcagattcattttacgctgctatgcgtctcattgtgccttctttt
gagagggagcgaatggcttatggtataaaagagaacatgcttgccaaactgtatattgag
gttttaggtctacctaaaaatggagatgaggcaaacaaacttttaaattacagagctcca
accacttctcaaggagaagcaggtgactttgcccttatggcctactttgtcctgaaaaaa
aggtgcacaagtcagggaaatttaagcattaaagaagtcaatgacttcttgggttctgta
gctaccaacaatgccagcaaacagaaggatcaagtgaagaaaagccttttgcatctaata
actcagagttcagctttggaacagaagtggctcattagaatgatcctcaaggacatgaaa
cttggcattagcaaggagactgttcttcaggttttccatccagatgcaccagaattctac
aatgtcaccacagatctgaataaagtatgcagacaacttcatgacccatctgtgtctctc
agtgaagtctccattgatctattctctgcttttaaaccaatgctggctgctgttgccaat
atcagacagatagagaagcaaatgggcaaccggcctttctacattgagacgaagctagat
ggtgaacgcattcaactgcacaaagctggagatgtttacaaatattacacaaggaattct
tatgagtatacccaacagtttggggcctctccactagagggctccctcacaccatacatt
cacactgtctttagccctcatgtggtgaactgcattctagatggagagatgatggcttat
aaccctaaaactgagaccttcatgcagaagggcagtaagtttgatattaaaaggctggtg
gatgactctgatttgcaaacctgcttttgcgtatttgatgtcttgttgataaacaatcag
aagtttggaaaggaacctctcaagaagcgttacgaaagtcttgagactgtcttctccccc
atcaaaggccgtatccacctggtctctaaatccgaaggcagaaccatgcaagaagtggtg
aattctcttaacgaggccattgacaatcgtgaagaggggattatggttaaggatccaatg
tccatttacaaaccagataaacgtggggaaggatggctaaagattaaacctgaatatgtg
gatgggctaatggatgaacttgatctgctgatagtgggtggttactggggtaaaggcagg
agaagtgggatgctttctcattttctctgcgcggtagctgaggtgccaagtcctggggaa
aagcccacggtgttccacacgctgtgtcgcattggatcaggctataccttaaaagaacta
tatgatcttggtgtgaagttggccaaacattggaaagtatacaacaaaaataatcctccc
gcagccattttgtgtgggacagaaaagccagaggtttacatagaaccacgcaactctgtg
atcttacaagtcaaagcagcagagatcgtcacaagcgaaatgtataagaccgactgcaca
ttgcgtttccctagaatagaaagaatccgagaagacaaagagtggcatcagtgcatgacc
ttggatgacctgaaccagtttcggtctaaagcttccggaaagctggcatcaagacatcta
aacatccatgaagaccagcctgaaaagaagaagcgcaaaatcgtcgccaagcccaagaag
accataggagtcattgaccactttaaatcccaggatttgtcaaaggttgccaaagagaca
gatatgtttgaagaggttgagttttgtgtgataaatggcgatgatgaacattccaaagca
gagcttgaaaaaggggtggcgcgctgtggaggcatcgttgtgcagaatcctggaaaggac
acgtactgcgccattgcagctgtgcagaacatgagagtgaagaacctcatctcatcagat
cagcatgatgtggtgtgggctacttggcttttagagtgtctggaaaataagcaggttatc
ccatggcaaccacgtcacatgatccacatgtcaccttccacaagggaacacttcgctaaa
gagtatgatcagtatggagacagttattacgttgacactagtgaacagcagctgagggat
gtcattgaaaggatcagctccgcagaagtcaagagtctgtctgtggctcagatagaagca
gagaatgcttgggatgacttgcctactagcatttttaggccttacagtgcatactttgac
cggtgtgctgacataggagatcccaagtctgttatctgcggtacgtgtttagacactcgt
gccttagaattcagatttcatggcggtaaagttgtggagaaactcaaagaaggaatctca
catgtggtagtagaagatatgaaaagggctctggacctaaagacactgaggcgacttcat
gccaagaagtttaaaattgttcatgaatcatgggttactgattccatcaaagcaggccat
gtaaaggatgagattgactacctgatttaa

DBGET integrated database retrieval system