KEGG   Danio rerio (zebrafish): 65223Help
Entry
65223             CDS       T01004                                 

Gene name
prss1
Definition
(RefSeq) cationic trypsin-3 precursor
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65223 (prss1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     65223 (prss1)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   65223 (prss1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   65223 (prss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16
AA seq 247 aa AA seqDB search
MKAFILLALFAVAYAAPLGDDDDKIVGGYECTKNGVPYQVSLNSGYHFCGGSLISNLWVV
SAAHCYKSRVQVRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQI
NSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQI
SSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI
RNTMNSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattcttctggctcttttcgctgtggcttatgccgctcctctgggagac
gatgatgataagattgttggtggatatgagtgcactaagaatggtgttccataccaggtg
tctctgaacagcggctaccacttctgcggtggctctctgatcagcaacctctgggttgtg
tctgctgctcactgctacaagtcccgtgtccaggtgcgtctgggtgagcacaacattgac
gtcactgagggaaccgagcagttcatcaactccgaaaaagtcatcagacaccccagctac
aacagcaacaccctggacaatgacgtcatgctgatcaagctgagcagctccgcccaaatc
aacagctacgttaagaccgtctctctgccttcaagctgcgcttcatctggaaccagctgt
ctgatctctggatggggaaacatgagcgccagtggaagcaattacccaagccgtctgatg
tgcctgaatgctcccattttgagcgacagcacctgcagaaacgcctaccctggtcagatc
tcctctaacatgttctgcgctggttttatggagggaggcaaggactcctgccagggtgac
tctggtggcccagttgtgtgcaacaaccagctgcagggtatcgtgtcctggggttatggc
tgtgcccagaggaacaagcccggtgtttacgccaaggtctgcaacttcaccacctggatc
agaaacaccatgaactccaactaa

DBGET integrated database retrieval system