KEGG   Danio rerio (zebrafish): 768131Help
Entry
768131            CDS       T01004                                 

Gene name
setdb1b
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    768131 (setdb1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     768131 (setdb1b)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     768131 (setdb1b)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    768131 (setdb1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
LinkDB All DBs
Position
16
AA seq 1214 aa AA seqDB search
MEVDAGLNSGMEMELEPELEEELGVSLDELRKWIEEQVDSSEAVQKRKADLEQLQEWVEQ
REKEVADIDALCSNASESVVQCEALVKEVYSNMGLVYRESSSDDEGGKANPSEVIEIDDD
DDDDVIAVGCLVPPKKSLTQAKDPALKEASAALQRTSQQVQNLAQTVNRTAQSGVTTPVK
TGGPPGQGPLAVPAVFMSSAPRNTPTQPNPNIKQDSIKINMTLLGKKRTKTWHRGTLVAI
KQVGNNLKYKVRFENKGKSLLSGNHVAFEYHPTLERLFVGARVVARYKDGNQVWLYAGVV
AEMPNSKNRMRFLIFFDDGYASYVGLPELYPICRPLKKTWEDIEDASCRDFIEEYITSYP
NRPMVLLKPGQIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMFNL
KMNTANSQEKKMAGQQRQRPNMGALRTKGPVVQYTSDNSAAASTGGGAATPGTPTRPVAP
QPAGPPQPSRTESPSFKSQMAKKSTGQLALQPRQGMPSDLQPKPIINALQTNTSRLFLLQ
SGPVHTLTPITPAPQTVQTAISTYTNERVPQEPSYQAPNDRLFYLTHNCSPECLKRIRPT
RPNLHRGRNPLLTPLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMTEIQRYLFQTQ
CDFIFLEMFCLDPYVLVDRRFQPQRPFYFIRDITSGREDIPLSCVNEIDNTPPPSVAYSK
ERIPEDGVYINTSADFLVGCDCTDGCRDKSKCSCHQLTLQATGCTPGGQINPNAGYHYKR
LDECLPTGIYECNKRCRCNMQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFV
CIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRV
KLPASSRHGKSNKMEERNSSTTGKSQDDSSEESDDEKDDDSNEDDSDSSDDTFVKDTYYT
TSSVWRSYTTRRQAKGLKEESQDSKDGMSVSAGEDRKPPHMPEETGKSKVASWLTNQSST
SANQSVKVEGGIKTEKKDVMTLSDSDDVQTISSGSDDNKEREKKTQAVVKRQVAVKSTRG
IALKSHSMMVKSGGGGAGGGGSGPSHGHGGGGGDNGPKNTRLFFDGEESCYIIDAKLEGN
LGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKEL
LCCCGSTECRGRLL
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggatgcaggtttaaactcagggatggagatggagctggaaccagagttggag
gaggagttaggagtgtctttggatgagctgcgcaagtggatcgaggagcaggtggacagc
agcgaggctgtgcagaagaggaaagctgatctggagcagctgcaggagtgggttgagcag
cgtgagaaggaggttgctgatatcgatgctctttgctccaatgcctcagagtctgtggtt
cagtgtgaagctctggtgaaggaagtgtacagtaacatgggtttagtgtatcgtgaaagc
agctcagatgatgagggaggcaaggcaaacccttctgaggtcattgagatcgatgatgat
gatgacgatgatgtcattgctgtgggatgtttggttcctcccaagaagagtttaactcaa
gccaaggacccagcgcttaaggaggcttcagctgcccttcaaagaacatctcagcaggtg
cagaacctggctcagactgtcaacagaacggcccaatcaggggtcactacaccagttaaa
acagggggccctcccggacaaggtcctctagctgttccagcagtgtttatgtcctcagcc
ccaagaaacacgcccactcaaccaaaccctaatataaaacaggacagtatcaagataaac
atgacgcttttgggtaaaaaacgaaccaagacgtggcatcgtggaacacttgttgccatc
aaacaagtgggcaacaatcttaagtacaaagtcaggtttgaaaataaggggaagagtctt
ctctctgggaaccatgtggcctttgagtaccacccaacactagagagactgtttgttgga
gcccgagttgttgccaggtacaaggatggtaatcaagtctggctgtatgcaggcgtagtc
gctgagatgcccaacagcaagaaccgtatgaggttcctgatcttttttgatgatggttat
gcctcatatgtgggcttgcctgagctctaccctatctgcagaccattgaaaaagacctgg
gaggatattgaggatgcgtcctgcagagatttcattgaggagtatatcacatcatatcct
aacagacccatggttttactgaagccagggcaaattataaaaactgaatgggagggaaca
tggtggaagagccgtgtggaagaagtggatggcagccttgtgaaaatgctcttcctggat
gataagcgaagtgaatggatttatcgtggctccacacgactagaacccatgtttaatctg
aaaatgaacacggctaacagtcaagaaaagaaaatggctggtcaacaaagacagcggcct
aatatgggagcactgaggacaaagggccctgtagttcagtacaccagtgacaatagtgct
gccgcatctactggtggtggtgccgcaactcctggcactcctactcgtcctgtagcccca
cagcctgctggacccccgcaaccgtcccgcacagagagtcctagttttaagagtcaaatg
gctaagaagagcactggtcaactcgcactgcagcctcgtcagggcatgccctctgacctt
cagcctaaaccaataatcaatgctcttcagaccaatacatccaggctcttccttttgcag
tctggacccgtgcacacgttgacaccaatcacaccagcccctcaaactgtgcagacagct
atttcaacctacacaaatgagcgcgtaccccaggagccgtcataccaggccccaaatgac
cgactcttctaccttacacacaactgctccccagaatgtcttaagcgcatcagacccacc
cgtccaaacctgcatcgaggacgcaacccactccttacaccattgctctatgaatttcgc
cgcatgactggccgcagacgccttaaccgaaagatgtcattccacgtcatctacaagtcc
ccgtgtggcttgagtctaaggaatatgacggagatccagcgctacctcttccagactcaa
tgtgacttcatcttcctggagatgttctgtctggacccctatgtgctggtggaccgccga
ttccaacctcagaggcccttctacttcattagagacatcacgagtggtcgtgaagacatt
cccctgtcctgtgtgaatgagattgacaacacgccaccacccagcgtggcctatagcaaa
gagaggatcccagaagatggagtatatattaataccagtgcagacttcctggtgggctgt
gactgcaccgatggatgcagagacaaatccaagtgctcgtgtcatcagctgactctacag
gctacaggatgtactccaggtgggcagatcaaccccaacgctggataccattataagaga
ctggatgaatgtctccctacagggatctatgaatgtaataagcggtgccgctgtaatatg
cagatgtgcactaatcgtctggttcagcacggtttgcaggtcagactgcagctctttaag
acccagaataaaggctgggggattcggtgtcttgatgacatcgccaagggctcctttgtt
tgcatctatgcaggaaagatcctgacagatgactttgccgataaagaaggtttggaaatg
ggcgatgagtattttgccaatctagaccacattgagagcgtggagaactttaaggaaggt
tacgagagcgaagcccactgctcggacagcgaaggcagcggtgtggacatgagcagagtt
aaactacctgcttcctcccgacacggtaaatccaacaagatggaggagcgtaacagcagc
acaactggcaaaagccaagatgattcctctgaagagagcgatgatgaaaaagatgacgac
tccaatgaggacgatagcgacagctcggatgacacttttgtgaaagacacatattacacc
accagttcggtgtggaggagctacaccactcgcagacaggccaagggattgaaggaagag
agtcaagacagcaaggatggaatgagtgtttctgcaggtgaggacagaaagcctccacac
atgccagaagagactggcaagagcaaagtggcatcttggctcactaaccagtcctctact
tctgccaatcagagcgtcaaggtggagggaggaataaagactgaaaagaaggatgtgatg
actctctccgacagtgacgatgtgcaaactatcagctcaggatcagatgacaataaggag
agagagaaaaagactcaggctgtggtgaagaggcaggtggctgtgaagtccacacgtggc
attgctttgaagtcccacagtatgatggtgaaatcaggtggagggggtgcaggaggcggt
gggtcaggcccgtctcacggccatggaggaggaggtggagacaatggccctaaaaacacc
cgcctgttctttgatggggaggaatcctgctacatcattgatgccaaactagagggcaac
ctcggacgctacctcaaccatagctgcagccccaatctgtttgtccagaatgtgtttgtg
gacactcacgacctgcgctttccctgggtggccttctttgctagcaagcgaatccgagca
gggacggagctgacgtgggactataattatgaggtaggcagtgtggagggcaaggaactt
ctgtgctgctgtggatcaacagaatgcagaggacgactgctgtaa

DBGET integrated database retrieval system