KEGG   Danio rerio (zebrafish): 768133Help
Entry
768133            CDS       T01004                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    768133 (ezh2)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     768133 (ezh2)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     768133 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     768133 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
24
AA seq 760 aa AA seqDB search
MGLTGRKSEKGPVCWRRRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTDILNQEW
KLRRIQPVHIMTPVSSLRGTRECTVDSGFSEFSRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALN
QYSDNEEDDEEDDHHDYKFEKMDLCDGKDDAEDHKEQLSSESHNNDGSKKFPSDKIFEAI
SSMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFQATPNTYKRKNMENLVDSKPCGIYCYMYMVQDGMVREYPAGVVPERAK
TPSKRSTGRRRGRLPNSNSRPSTPTVNSETKDTDSDREGGADGNDSNDKDDDDKKDETTS
SSEANSRCQTPVKLKLSSEPPENVDWSGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQV
YEFRVKESSIIARAPAVDENTPQRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCL
TCGAAEHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaccgggaggaaatcggagaagggtcctgtttgctggaggcggcgagtgaag
tctgagtacatgcggctgcggcagctcaaacgcttcaggagggcagacgaggtcaagagc
atgttcagctccaacagacaaaaaatactggagcgtactgacatcttaaatcaggaatgg
aaactgaggaggatacagcctgttcatattatgacacctgtgagctccttgcgtggaacc
agagagtgcactgttgacagtggcttttctgagttctccagacaagtcattcccctcaaa
acactgaatgccgtggcctctgttcctgtcatgtactcgtggtctcccctccagcaaaac
tttatggttgaagatgagaccgtattgcacaacatcccatacatgggtgatgaaatcctt
gatcaagacggcaccttcatagaagagctgattaaaaattatgatggaaaagttcatgga
gatcgagagtgtggcttcataaatgacgagatttttgtggagttggtgaatgcactcaat
cagtacagtgataatgaggaagatgatgaagaggatgatcatcatgattataagtttgaa
aagatggacctctgtgatggaaaagatgatgctgaagaccacaaggaacagctgagttct
gagagtcacaacaacgatggatcaaaaaagtttccctctgataaaatctttgaagccata
tcttcgatgtttcctgacaaagggtcaactgaagaactcaaagaaaaatataaagaactc
actgagcagcagctcccaggggctcttcctcctgaatgcacccccaacattgatggacca
aatgccaaatcagtgcaaagagagcagagtctgcactccttccataccctcttctgcagg
cgttgcttcaaatacgattgcttccttcacccttttcaagcaactccaaacacatacaag
cggaagaacatggaaaatctggtggatagcaaaccttgtggcatttattgctacatgtat
atggttcaggatggcatggttagggaatacccagcaggtgtggttcctgaacgtgccaag
accccttcaaagcgcagtacaggccgacgcagaggaaggctcccgaacagcaacagcaga
cccagcacgccaaccgtcaactctgagactaaagacacagacagcgaccgagagggtgga
gcagatggaaacgacagcaatgataaagatgatgatgacaaaaaggatgagaccaccagc
tcttcagaggcaaactctcgctgtcagactccagtgaagctgaagttgagctcagagcct
cctgagaatgtggactggagcggtgcggaggcgtctctgttcagggtgctcatcggcact
tactacgacaacttctgtgctatagccagactcatcggcacaaagacctgtagacaggtt
tatgaattcagggtaaaagaatctagcatcattgcaagagcacctgcagtggacgaaaac
actcctcaaagaaagaagaagaggaaacacagattgtgggctacacattgtcgaaaaatt
caactaaagaaagatggctcctctaatcatgtgtataactaccagccatgtgatcacccg
cgccagccatgtgacagttcttgcccttgtgtcacagcccaaaacttctgtgagaagttc
tgccagtgtagctcagaatgtcagaatcggtttccaggttgccgctgtaaggcccagtgt
aacaccaagcagtgtccgtgttacctggctgtacgagagtgtgaccctgacctgtgcctc
acctgtggggcagctgagcactgggacagtaaaaacgtctcctgcaagaactgtagcatc
cagagaggagcaaagaagcatttgctgctggctccatctgatgtggccgggtggggaatc
ttcatcaaagagccggttcagaagaatgagttcatctcagagtactgcggggagatcatc
tcgcaggatgaggcagatcgcagaggcaaagtctatgacaaatacatgtgcagcttcctc
ttcaaccttaacaacgactttgttgttgatgcgacaaggaaaggaaacaagatcagattt
gccaaccactcggtgaaccccaactgctatgcaaaagtgatgatggttaatggggatcac
aggattggcatatttgcgaagagagccatacagaccggagaggaactcttcttcgactat
agatacagtcaagcggatgctctgaaatatgtaggtattgaacgtgaaatggaaattcca
tga

DBGET integrated database retrieval system