KEGG   Desulfotomaculum ruminis: Desru_0782Help
Entry
Desru_0782        CDS       T01518                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desru_0782
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Desru_0782
Enzymes [BR:dru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desru_0782
Peptidoglycan biosynthesis and degradation proteins [BR:dru01011]
 Precursor biosynthesis
  Racemase
   Desru_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
797761..798873
Genome map
AA seq 370 aa AA seqDB search
MNEPIWAEVNLGAIRHNIQEVRRLVGPHREIMAVLKANGYGHGSVPAARASLEAGASRLA
VARLGEALALREAGIDAPILVFGFILPEELEKAIDNKISITVYRRDMAETISDAAQKLGR
EATVHLKVDTGMGRLGFLPGKEGIEEIKRVNTLKGLFLEGIYTHFATADEKDKQYARRQL
DQFLSFVEELKTQGISFALRHCANSAAIIDLPEAHLDMVRPGIIIYGMYPSDEVDRTKVS
LQPAMVLKTRVSHLKKMQAGAKISYGCTYTVPAETMIASLPLGYADGYPRLLSSRGQVLI
RGQKAPVVGRVCMDQCMVDVGHIPDVQVGDEVVVFGDEKLPVEEMAAWLGTINYEVVCLV
GSRVPRIFIE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcctatctgggcggaagtcaacttgggagcaattcgtcacaatatccaagaa
gtaagaagactggtgggtccccacagagagattatggcggtgctcaaagcgaacggttat
ggacatggcagtgttccggcggcaagggcctctttggaggccggtgcttcaagattggcg
gttgccagactgggtgaggccttagcgctgcgggaagcgggaattgatgcgcccattctg
gtctttggcttcattttgccggaggaattggaaaaggccattgataataaaatatccata
acggtatatcgcagggatatggcggagaccatttccgacgcagcccagaagttgggccgg
gaagcgaccgtacatttaaaggtggataccggtatgggtcgactgggttttttgcccggt
aaggaaggaattgaagagataaagagagtaaatactttgaagggcctttttttggaaggg
atctatactcactttgccacggcggatgaaaaagataagcaatatgcccgccggcaattg
gatcaatttttatcctttgttgaagaactgaaaacccaagggatttcctttgcccttcgt
cattgcgccaacagcgccgccatcatcgaccttcccgaagcccacttggatatggttcgc
ccggggattataatttacgggatgtatccctcggatgaggtcgaccgcaccaaggtaagc
ttacagccggccatggtactaaagacccgggtttcccatctgaaaaagatgcaggccggg
gctaaaatcagctatggctgtacttataccgtaccggcggaaaccatgatcgcctccctg
ccccttggttatgccgatggatatccccggttgctttcttcccggggacaggttctgatc
cgtggtcaaaaggcgccggtggtgggaagggtctgcatggatcagtgtatggtggatgtg
gggcacataccggatgtccaggtgggggatgaagtggttgtttttggtgatgaaaaattg
cccgttgaagaaatggccgcttggttgggcacaataaactacgaagtggtatgcctggta
gggagcagggttccgcggatctttattgagtaa

DBGET integrated database retrieval system