KEGG   Desulfotomaculum ruminis: Desru_1852Help
Entry
Desru_1852        CDS       T01518                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
Organism
dru  Desulfotomaculum ruminis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1867586..1868536
Genome map
AA seq 316 aa AA seqDB search
MRQEKELPNLKPMLAVKAAPFDSDDYLYEIKWDGYRALAYLNQQTLLYSRNQLDLTKSFP
DLQGLHLRVKQKPLILDGEIVVLKDGKPSFSALQSRGKLSDPLKIRRLCQQNPATFVVFD
VLFSNGRNLMNLPLLQRKKFLEEMAEQGPDLIVSQYVLGSGCEFFRVVKAAGLEGMVAKR
LDSPYLPGKRSGYWKKIRWVQSADLVICGWEKGEGQRLLGALILGVPEKGGWVYMGKVGT
GFSREEEKRIITLLKPLEGHPPFSSLPDEDFRKTVWVCPELVCEVTFSEISPEGRLRHPS
YKGLRKDKKAEECGHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggaaaaagaactacccaatttaaagcccatgctggcggtgaaggccgctccc
tttgacagtgacgattacttgtatgaaattaagtgggacggctatagggcattggcctat
ctaaatcaacaaacccttctttattcccgcaatcaactggatcttaccaaaagttttcca
gacctgcagggactgcatctcagggtaaagcagaaacccctcattttagacggtgaaatt
gtggtattaaaggacggaaaaccttccttcagcgctctacaatccaggggcaagctcagt
gatcctttgaagatacgcaggctttgccaacaaaatcccgctacttttgtggtctttgat
gtactttttagcaacgggaggaatttaatgaaccttccccttctccagaggaaaaaattt
ctggaggaaatggcggaacagggaccggatttaattgtctcccagtatgtgctgggttcc
ggttgtgagttctttagggtggttaaagccgcaggtttggaaggaatggtagctaaaaga
ctggacagcccttacttaccgggtaaaagatccggctactggaaaaaaatccgttgggtt
cagtccgccgatctggttatttgtggttgggaaaagggagaagggcagagattgttggga
gcactgattttaggcgtcccggagaagggaggctgggtatatatggggaaggtagggacg
ggttttagtagggaagaggagaaaagaatcattactttgttaaaacctttggaaggacat
ccccccttttccagcctgccggatgaggattttcggaaaaccgtctgggtttgtccggaa
ttagtttgcgaggttacctttagtgagatcagcccggaggggcggttgaggcacccaagt
tacaaggggctgcgcaaagataaaaaggcggaagaatgcggccacctataa

DBGET integrated database retrieval system