KEGG   Drosophila sechellia: Dsec_GM25792Help
Entry
Dsec_GM25792      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM25792-PA
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dse  Drosophila sechellia
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dsec_GM25792
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dsec_GM25792
Chromosome [BR:dse03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dsec_GM25792
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dsec_GM25792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 1024 aa AA seqDB search
MATAEAQIGVNRNLQKQALSNWDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIKKLLSSKQQRQQYEIKQRSMLRHLAELRRHSR
FRRLCTKPAPSSMPASTSSAARRTTRRSTSQSSLSPSNSSGYGSVFGCEEHDVDKISSHK
GFAKLKRRRSSCVGAPTSNSKRTKNNEGLVAKKPPKGEYVVERIECVEIDQYQPVFFVKW
LGYHNSENTWESLANVADCAEIEKFVERHQQLYETYIAQITTELEKQLEALPLMENITVA
EVDAYEQLNLQIDLILLAQYRAAGSRSQREPQKIGERALKSMQIKRAQFSRRKQLADLAL
FEKRMNHVEKPSPPIRVENNVDLDTIDSNFMYIQDNIIGKDVPKPEVGIVGCKCTEDTGE
CTASTKCCARLADELFAYERSTRRLRLRPGSAIYECNSRCSCDSSCSNRLVQHGRQVPLV
LFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNGRTYLFDLDYNTA
QDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEELSF
DYIRADNEAVPYENLSTAVRVECRCGADNCYANAKIYKCDNPKCPRPASFVSDASSKDDS
LPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSE
HLAAIEIMKLKQILILQNKIDLIKESQAKEQYEEITKFVQGTVAEGAPIIPISAQLKYNI
DVLCEYIVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVADLKGGVAGGSILSGVLKVGQ
EIEVRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGVGTKIDPTLCRADR
LVGQVLGAVGQLPDIYQELEISYYLLRRLLGVRTDGDKKGARVEKLQKNEILLVNIGSLS
TGGRISATKGDLAKIVLTTPVCTEKGEKIALSRRVENHWRLIGWGQIFGGKTITPVLDSQ
VAKK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagcccagatcggtgtgaacaggaacttgcagaagcaagccctcagc
aactgggacgtctccaaactaacgcctctgtcaccggaggtcatctcccgacaggcgacc
atcaacatcggcaccatcggtcatgtggctcacggcaaatccacggtggtcaaagccata
tccggcgtgcagactgtgcgcttcaagaacgaactggagcgcaacatcacaatcaagctg
gaacgcttgagcgaaaagaaaatcaagaaacttttgagctccaagcagcagcgacagcag
tatgaaatcaaacagcgttcaatgctacgccacctggccgaattacggcgacatagccga
ttccgccgcctctgcaccaagccagctccgtcttccatgccagcatcaacctccagtgca
gctagacgcaccacccggcgaagcaccagtcagagctcactgagtcccagcaatagtagc
ggctatggcagcgtttttggctgcgaggaacatgatgtggacaaaatatccagtcacaag
ggattcgccaaactgaagcgtcgacgcagcagttgtgtgggagccccgacttccaactcc
aagcggacgaaaaataacgagggactagtagccaaaaagccgcccaaaggagagtacgtt
gtggagcgtattgaatgcgttgagattgatcagtatcagccagtcttcttcgtcaaatgg
ttgggataccataatagcgagaacacctgggaaagtcttgccaacgtggccgactgcgcc
gaaatcgagaagtttgtggagcggcatcagcagctctacgagacatacatagcccagata
accactgagcttgagaagcagctggaggcattgccacttatggagaacattacggtggcc
gaagtagatgcctatgagcaactcaatctgcagatcgatcttatcctgctcgcccaatat
cgcgctgctggcagtcgaagccaaagggaaccgcagaaaattggagaacgagccctgaaa
agcatgcaaatcaagcgggctcaattttcacggcgcaagcagttggctgatctagcattg
ttcgagaagcgcatgaatcatgtggagaaaccgtcacctccaatacgtgttgagaacaac
gtagatctggacactatagacagcaatttcatgtacatacaggataacataatcggcaag
gatgtgcccaagccggaagtgggaattgtgggctgtaagtgcactgaagacacaggggag
tgtactgcctctacgaagtgttgtgcccgcctcgccgacgagctgttcgcctacgagcga
agcacacggcgcttgcgcctacgtccaggaagtgccatctacgagtgcaatagccgctgc
tcgtgcgattcaagctgctccaaccgtctggtgcagcatggacgccaggtaccgttggtt
ttgtttaagaccgccaacggcagcggatggggggtgcgagccgcaactgccctgcgtaag
ggtgaatttgtgtgcgagtacattggagagatcatcaccagcgatgaggcaaatgagcgc
ggcaaggcgtatgacgacaatgggaggacatatcttttcgatttggattacaacacagct
caggacagcgagtacactatcgatgcggctaactatggcaacatctcgcactttatcaat
cactcttgcgatccaaatctcgccgtgttcccctgctggatcgagcacctgaatgtcgca
ctgccgcacctcgtcttctttacactgcgtccaatcaaggcgggcgaggagttgagcttc
gactacattcgcgcggacaacgaagccgtgccctacgagaacctctcgacagctgtgcgc
gtcgagtgccgctgcggagctgataattgttatgccaacgccaaaatctacaagtgcgac
aaccccaagtgcccgcgcccagccagctttgtatcggatgcatccagcaaggacgacagc
ttgccctgcacccggctcaactgctccggcaactttagactagtgcgacatgtgagcttc
gtggattgccccggtcacgacattcttatggctaccatgttgaacggtgctgctgtgatg
gatgccgctctgctgctcattgctggcaatgaatcctgtccacaaccgcaaacctctgag
catttggccgccattgagattatgaagctgaaacagattctaatcttgcaaaacaagatc
gatctgatcaaggagagccaggcgaaagagcagtacgaggagatcaccaaattcgtccag
ggcaccgtagctgagggcgctccgatcattccgatctcggcccagcttaagtacaacatc
gatgtgctctgcgagtacattgtgaataagatcccagtgccgccgcgcgacttcaatgcc
ccgccccgtctgatcgtcatccgatccttcgacgtgaacaagccaggctgtgaggtggca
gaccttaagggcggtgtcgcaggtggctccatcctgagcggcgtgctgaaggtaggacaa
gagatcgaggtgcgtccaggcgttgtgaccaaggacagcgatggcaacatcacctgccgt
ccaatcttctcccgtatcgtctcgcttttcgccgagcagaacgagctgcagtacgccgtg
cccggcggtctgattggtgtgggcaccaagatcgatcctacgctgtgccgtgccgatcgt
ttggtcggtcaggtgctaggcgccgttggacaactgccagacatctaccaggagctggaa
atctcgtactacctgctgcgtcgccttctcggcgtccgtaccgatggtgacaagaaggga
gcgcgcgttgaaaagctgcagaagaacgaaattctgttggttaacatcggatcgctcagc
actggcgggcgcatctcggccaccaaaggtgatttggccaagatcgttcttacgacgccg
gtgtgcacggagaagggcgaaaagattgcactcagcagacgtgtggagaaccattggcgt
ttgattggctggggtcagatcttcggaggcaagacaatcacacccgttctggacagtcag
gtggcaaagaagtag

DBGET integrated database retrieval system