KEGG   Drosophila simulans: Dsimw501_GD10425Help
Entry
Dsimw501_GD10425  CDS       T01065                                 

Gene name
Dsim_GD10425
Definition
(RefSeq) GD10425 gene product from transcript GD10425-RA
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
dsi  Drosophila simulans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsimw501_GD10425 (Dsim_GD10425)
  Energy metabolism
   00190 Oxidative phosphorylation
    Dsimw501_GD10425 (Dsim_GD10425)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dsimw501_GD10425 (Dsim_GD10425)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2R
AA seq 297 aa AA seqDB search
MLATEARQILSRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAG
EKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC
ISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
NKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaccgaggcgagacagatcctgagccgcgtgggatccctggtggccaggaac
cagatgcgagccatcagcaatggcaccgcccagctggagcagcaggcgcagcccaaggag
gcccaggagccgcagataaagaagttcgagatctaccgctggaacccggacaacgccggc
gagaagccgtacatgcagacctatgaggtggacctgcgcgagtgcggccccatggtgctg
gacgcgctgatcaagatcaagaacgagatggaccccacacttaccttcaggcgctcctgc
cgcgagggcatctgcggttcctgcgccatgaacataggcggcaccaacacgctggcctgc
atcagcaagatcgacatcaacacctccaagtcgctaaaggtgtacccgctgccccacatg
tacgtggtgcgcgacctggtcccggacatgaacaacttctacgagcagtaccgcaacatc
cagccctggctgcagcgcaagaacgaggcgggcgagaagaagggcaaggcccagtacctg
cagtccgtcgaggaccgctccaagttggacggcctgtacgagtgcatcctgtgcgcctgc
tgctccacctcgtgcccctcgtactggtggaacgccgagaagtacctgggccccgccgtg
ctgatgcaggcctaccgctggatcatcgactcgcgtgacgagaactccgccgagcgtctg
aacaagttgaaggaccccttcagcgtctaccggtgccacacgatcatgaactgcacgcgc
acctgccccaagggcctcaatcccggccgggccatcgctgagatcaagaagctgctttcg
ggcctggcctccaagccggctccgaagctggagacggcggcgctgcacaagtag

DBGET integrated database retrieval system