KEGG   Drosophila simulans: Dsimw501_GD12292Help
Entry
Dsimw501_GD12292  CDS       T01065                                 

Gene name
Dsim_GD12292
Definition
(RefSeq) GD12292 gene product from transcript GD12292-RA
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
dsi  Drosophila simulans
Pathway
dsi00010  Glycolysis / Gluconeogenesis
dsi00053  Ascorbate and aldarate metabolism
dsi00071  Fatty acid degradation
dsi00260  Glycine, serine and threonine metabolism
dsi00280  Valine, leucine and isoleucine degradation
dsi00310  Lysine degradation
dsi00330  Arginine and proline metabolism
dsi00340  Histidine metabolism
dsi00380  Tryptophan metabolism
dsi00410  beta-Alanine metabolism
dsi00561  Glycerolipid metabolism
dsi00620  Pyruvate metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD12292 (Dsim_GD12292)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
   00620 Pyruvate metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
  Lipid metabolism
   00071 Fatty acid degradation
    Dsimw501_GD12292 (Dsim_GD12292)
   00561 Glycerolipid metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
   00280 Valine, leucine and isoleucine degradation
    Dsimw501_GD12292 (Dsim_GD12292)
   00310 Lysine degradation
    Dsimw501_GD12292 (Dsim_GD12292)
   00330 Arginine and proline metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
   00340 Histidine metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
   00380 Tryptophan metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsimw501_GD12292 (Dsim_GD12292)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Dsimw501_GD12292 (Dsim_GD12292)
    1.2.1.8  betaine-aldehyde dehydrogenase
     Dsimw501_GD12292 (Dsim_GD12292)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     Dsimw501_GD12292 (Dsim_GD12292)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 6738663
NCBI-ProteinID: XP_016032485
UniProt: B4QQE4
LinkDB All DBs
Position
3L
AA seq 540 aa AA seqDB search
MLAHLRNISKLAVPRRLVTQSASYSSSSSFLIDQPEYSFLKELGLERDNPGVYSGQWQGR
GPSVTSYDPGTGRPIAKVRQGNVQELEQTIGLAVEAYKQWRQVPAPVRGEIVRQIGDELR
KYKEPLGKLVSLEVGKIYSEGQGEIQEFIDICDYAVGLSRIYSGQLINSERADHSILEAW
RPLGVVGVISAYNFPNAVFGWNAAIALTTGNSVLWKGAPSTPLVSVATTKIVAEVLRRNN
LPPVVALCQGGTDVGQTLVADKRVNLVSFTGSCQTGRDVGVEVQRRFGKVILELGGNNAL
IIDESANVKMALDAALFGCIGTSGQRCTTTRRIIVHEKLHDQFVKELVGKYKQLIPKIGH
QLEAQTLVGPVHTQQNVENYKVAIAEAKSLGGTVAFGGNVIQRDGFYVEPTVITGLPHDA
SVVHRETFAPIVYILKAKNVDQAIEWNNEVEQGLSSAIFTENIGQAFKWIGAKGSDCGIV
NINTTTNGAEIGGAFGGEKATGGGRESGSDAWKQYCKRATITVNHSGELACAQGVVFNVE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgttggcacacttgagaaatatttcgaagctggcggtgccgcgccgcctggttacccag
tccgccagctactcatcatcctcatcatttctcattgatcagccggagtacagtttcctg
aaagaattgggactggagcgcgacaatccaggtgtttattcgggtcagtggcaaggtcgt
gggccatccgttaccagctatgatcccggaactggtcgaccgattgccaaagtgcgtcag
ggaaatgtccaggagctcgagcagaccatcgggctggcggtggaagcctacaagcagtgg
cgacaggttccagctcccgtccgcggcgaaatagtccgccaaatcggcgatgagctgaga
aagtacaaggaacccctaggaaagctcgtctccctggaggtgggcaaaatctacagcgag
ggacagggcgagattcaggagttcatagatatctgcgactatgccgttggcctctccagg
atttactccggccagctgatcaactcggagcgtgcggatcactcgattttggaggcctgg
cgtccgctgggagtggtgggcgttatttcggcctacaatttccccaatgctgtgttcggc
tggaatgctgctatcgccctaaccaccggcaacagtgtgctgtggaagggagctcccagc
actcccttggtctcggtggcgaccacgaaaattgtggctgaagtgctgcgcaggaacaat
ctgccgccggtggtggctctctgccaaggaggaaccgatgtgggtcagaccttggtggct
gataagagagttaacctcgtttccttcaccggcagctgccagactggtcgggatgtgggc
gtcgaagtgcagcgcagatttggcaaggtgatcctcgagttaggcggtaataatgcccta
atcattgatgaatctgccaacgtgaagatggccctggacgcagcactcttcggctgcatt
ggcaccagtggtcaaagatgcaccaccaccagaaggattattgtccacgaaaagctgcac
gatcagttcgtaaaggagctggttggtaaatacaaacagctaattcccaagattggccat
cagcttgaagctcaaaccctggtgggtcccgtgcacacgcaacaaaacgtggagaactac
aaggtggccatcgcggaagcgaaatccttaggaggaacggtggccttcggaggcaatgtc
atccagagggatggtttttacgtagagcccactgtgatcactggtttgccgcacgatgcc
agcgttgtccatcgcgaaacctttgcaccgatcgtgtacatcctcaaagccaaaaacgtg
gaccaggccatcgaatggaacaatgaggtggagcagggcttatcctctgccattttcacc
gaaaacatcgggcaggcattcaagtggattggagccaagggttccgattgcggtatcgtc
aacatcaacaccaccaccaacggcgccgagattggaggagctttcggaggcgaaaaggcc
actggaggaggtcgcgagtccggatcggatgcctggaagcagtattgcaagcgggccacc
attacagtcaaccactccggggaattggcctgcgcccagggcgttgtcttcaatgtggag
tag

DBGET integrated database retrieval system