KEGG   Drosophila simulans: Dsimw501_GD14100Help
Entry
Dsimw501_GD14100  CDS       T01065                                 

Gene name
Dsim_GD14100
Definition
(RefSeq) GD14100 gene product from transcript GD14100-RA
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dsi  Drosophila simulans
Pathway
dsi00480  Glutathione metabolism
dsi00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsimw501_GD14100 (Dsim_GD14100)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsimw501_GD14100 (Dsim_GD14100)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dsimw501_GD14100 (Dsim_GD14100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 6737295
NCBI-ProteinID: XP_002084135
UniProt: B4QM37
LinkDB All DBs
Position
3L
AA seq 243 aa AA seqDB search
MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEW
LLDKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIER
FGAVLGAFFKASDGGDLEPFWSGLDIYEKELARRGTEFFGGEQTGILDYMIWPWCERLEL
LKLQRGEDYNYDESRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggcaggcatttggctaaaggctcacccatgccggatgttcccgaggatggt
atcctccgcctgtactcgatgcgcttctgcccatttgcccaaagggtgcatctggtcctg
gacgccaagcagatcccgtatcacagcatctacattaatctcacagacaagccggagtgg
ctgctggacaagaatccacagggcaaggtgccggctctagaaatcgtgcgagaacctgga
ccacctgtgctcacagagtcgctactgatttgcgaatatctggacgagcagtatccactg
cgaccactctatccacgtgatccgctgaagaaagtgcaggataagctactaatcgagcga
tttggagcggtgctaggtgcctttttcaaggcatccgatggcggtgatctggagcccttc
tggagcggcctggacatctacgaaaaggagctggctcgccgtggtacggaattcttcggt
ggcgaacagacgggcattctggactacatgatttggccctggtgtgagcgcctcgagctc
cttaagttgcagcgtggagaggattataactacgatgagagccgcttcccccagctgacc
ctttggctggaacgcatgaaacgggatccggctgtgatggccttttacatggaggccgag
gttcaggcggagttcctgcgcacacggagcctgggtcgacccaactacaatctgctggtc
aaggatgcctga

DBGET integrated database retrieval system