KEGG   Dactylococcopsis salina: Dacsa_1769Help
Entry
Dacsa_1769        CDS       T02378                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dsl  Dactylococcopsis salina
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dacsa_1769
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Dacsa_1769
Enzymes [BR:dsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Dacsa_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1800589..1800975
Genome map
AA seq 128 aa AA seqDB search
MTQTLLNSLFVNTGFETMKTTPKQAFYETLSYLPPLTDQQIAKQIQYMLDQGFIPAIEFE
ESPKPQDHHWTLWKLPLFDASSPQDVLNEVRECRSEYSNCYIRVVGFDNIRQCQMVSFIV
YKPDGIRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgctactgaatagtctctttgtaaatactggatttgaaaccatgaaaaca
acaccgaaacaagccttttacgaaaccctttcttatttacctcctctcactgatcagcaa
attgccaagcaaattcagtatatgctggatcaaggctttatccctgctattgagtttgaa
gagtcccctaaacctcaagatcaccactggacattgtggaaattacctttatttgatgca
agttctcctcaagatgtcttaaatgaggtgcgggaatgccgttctgagtattctaactgc
tacatccgtgttgttggttttgataatatccgtcaatgccaaatggttagctttatcgtt
tacaagcccgacggtatccgttattaa

DBGET integrated database retrieval system