KEGG   Dactylococcopsis salina: Dacsa_2555Help
Entry
Dacsa_2555        CDS       T02378                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dsl  Dactylococcopsis salina
Brite
Enzymes [BR:dsl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dacsa_2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFZ51144
UniProt: K9YW67
LinkDB All DBs
Position
2586763..2587365
Genome map
AA seq 200 aa AA seqDB search
MGYELPALPYDYTALEPAISKSTLEFHHDKHHAGYVKKFNAAVEGTELDSKPIEDVIKAV
AGDDSKTAIFNTGAQAWNHTFYWNSMKPNGGGTPTGELAQKIDADFGSFEKFKEAFKAAG
TGQFGSGWAWLVLDNGTLKVTKTLNADNPLTKGQTPLLTMDVWEHAYYLDYQNQRGTYID
AFLDQVVNWEFAAENFAKAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggatacgaactaccagcacttccttacgattacacagctttagaaccagcaatttct
aaatcaaccctcgaatttcatcacgacaaacatcatgctggctatgtcaaaaaattcaat
gctgccgtagaaggaacagaattggatagtaaaccgatagaagacgtgattaaagcggtt
gctggagatgacagcaaaacagcgattttcaacacaggcgctcaggcttggaatcatacc
ttttactggaattcgatgaaacccaacggcggtggaacacccacaggagagttagcacag
aaaattgatgctgattttggcagctttgaaaagttcaaagaagcgtttaaagccgcagga
actggtcaatttggtagtggctgggcatggttagtcttagacaatggaacgctgaaagtg
accaaaactcttaatgctgataatcctctcactaaaggacaaaccccactgctaacaatg
gatgtttgggaacacgcttattatttagattatcaaaatcagcgtggcacttatatcgat
gcgtttttggatcaggttgtaaactgggaatttgcggcggaaaatttcgctaaggcaaag
taa

DBGET integrated database retrieval system