KEGG   Dactylococcopsis salina: Dacsa_2754Help
Entry
Dacsa_2754        CDS       T02378                                 

Definition
(GenBank) glutathione S-transferase
Organism
dsl  Dactylococcopsis salina
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2825548..2826240
Genome map
AA seq 230 aa AA seqDB search
MTIKLYSASVCPFAHRTRLTLLEKGLDFQLIEIDLNNKPDWFSEISPYGKVPVIKHDNNC
IWESAIINEYIDEAFPDISLMPKTASDRAFARIWIDFANTKLVPVFYKMLLEQDPEKQTK
WKNQFREHLNFMETEGMRKLSENGDYWLGDRLSLVDLTFYPWFERFCILEHYRSVFLPKT
CSFLQHWWRTMSERDSVQNIKNASEFYIAQYQKYANNTVNSVTAQEMRDN
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaactttatagcgcgagtgtttgtccttttgcccatcgcactcgtttaacg
ttactagaaaaaggacttgatttccaactgattgaaattgatcttaataacaagccagat
tggttttctgagatttctccttatggcaaagttcctgtcattaaacacgacaataattgc
atctgggaatcagcgataattaacgaatacattgatgaagcatttcccgatatttcttta
atgccaaaaacggcatccgatcgagcttttgctagaatttggattgattttgccaacaca
aaactcgttcctgtattttataaaatgttgttggaacaagacccagaaaaacagaccaaa
tggaaaaatcaattccgagaacacttaaactttatggaaactgaaggcatgagaaaactg
agtgaaaacggcgattattggctcggcgatcgtctttctcttgttgatttaaccttttat
ccctggtttgaaagattctgtattttagaacattatcgatcggtttttctccctaaaacc
tgttcttttcttcaacattggtggcgcacaatgtcagaacgagactcggtacaaaacatt
aaaaatgcttcggagttttatattgcacaataccaaaaatatgctaataatacggttaat
agtgtcaccgctcaagaaatgcgcgacaactaa

DBGET integrated database retrieval system