KEGG   Dickeya solani: A4U42_07395Help
Entry
A4U42_07395       CDS       T04410                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dso  Dickeya solani
Pathway
dso00564  Glycerophospholipid metabolism
dso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dso00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A4U42_07395
Enzymes [BR:dso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A4U42_07395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 DAO_C Pyr_redox_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ANE75175
LinkDB All DBs
Position
complement(1773958..1775601)
Genome map
AA seq 547 aa AA seqDB search
MANDGLRRETDVVIIGGGATGAGTARDCALRGLRCLLLERHDIATGATGRNHGLLHSGAR
YAVTDAESARECIEENQILRRIARHCIEPTDGLFLTLPQDDLDYQARFVAACRQAGIPAQ
AIDPQEALRLEPAANPSLIGAVRVPDGTVDPFRLTAANMIDACEHGAEVLTYHEVIGLIR
QGDRVIGVRVFDHKRHLASEIYAQVVVNAGGIWGQRIAEYADLTVRMFPAKGALLILGHR
INNRVINRCRKPADADILVPGDTISLIGTTSTRIDYDQIDRMTVTPEEVDTLIREGSLLA
PQLAQTRILRAYAGVRPLVASDNDPSGRSVSRGIVLLDHASRDGLEGFVTITGGKLMTYR
LMAEWVTDKVCEKLGHRAECATASRPLPGSETQNPDTPQAASPLSAPLRGSAIYRHGHRA
APLVSGQRVDSSLVCECEAVTAGEVRYAVESLQVNNLTDLRRRTRVGMGTCQGELCACRA
AGLLCRLGQSTPHQAVSQLSQFLNERWKGMRPIAWGHTLRESEFTSWIYQGLCGLTESRE
QENSDAL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgatggtttgcggcgtgaaacggatgtggtgattatcggcggcggcgccacc
ggtgcagggaccgcccgcgactgcgcgttgcgtggtttgcggtgcctgctgctggaacgg
cacgacatcgccactggcgccaccggtcgtaatcatgggttgttgcacagcggggcgcgt
tatgcggtcactgatgctgaatccgcccgcgaatgcattgaagaaaaccagattctgcga
cgcatcgcccgccactgtattgagccgaccgacggcctgtttctgacgttgccgcaggat
gacctcgactatcaggcgcggtttgtcgccgcctgccggcaggcagggatcccggcgcag
gcgatcgatccgcaggaggcgttgcgactggagccggcggccaatccgtcgttgatcggc
gcggtacgggtgccggacggtaccgtggacccgttccggctgaccgccgccaatatgatc
gacgcctgcgagcatggcgcggaagtgctgacctatcacgaggtcatcgggttgattcgc
cagggcgaccgcgtcatcggcgtgcgcgttttcgaccacaaacgccacctggccagcgag
atttatgcgcaggtggtggtgaacgcgggtggtatctgggggcagcgtatcgctgaatac
gccgacctcaccgtgcgcatgtttccggccaagggcgcgctgttgattctgggccaccgc
atcaacaaccgggtgatcaaccgctgccgtaagccggcggacgccgacattctggtgccg
ggcgacaccatttcgctgattggcaccacctcgacccgtatcgactacgaccagatcgac
cggatgaccgttaccccggaggaagtcgataccctgatccgcgaaggcagcctgctggcg
ccgcaactggcgcaaacccgcattctgcgcgcctacgccggggtgcggccgctggtggcg
agtgataacgacccgtccgggcgcagcgttagtcgcggtatcgtgctgctggaccacgcc
agccgggacgggctggaagggtttgtcaccattaccggcggcaagctgatgacctatcgg
ctgatggcggaatgggtgacggacaaggtatgcgagaagctcggccaccgagccgaatgc
gccaccgcgtcacggccgttaccggggtcggagacgcagaatccggacacgccgcaggcc
gcgtcgccgctgtcggcgccgttgcgcggctcggcgatttatcgccacggacatcgcgcc
gcgccgttggtttccggccagcgggtggacagcagtctggtgtgtgaatgcgaagcggtg
acggccggcgaggtgcgttatgcggtggaatcgctgcaggtcaacaacctgactgacctg
cgccgccgtacccgcgtcggcatgggcacctgtcagggggaactgtgcgcctgccgcgcg
gccggcctgttgtgccggctgggacagtccacgccgcatcaggcggtgtcgcaattgagc
cagtttctcaacgagcgctggaaaggcatgcgccccatcgcctgggggcacacgctgcgg
gaaagcgaatttaccagttggatttatcaggggctgtgcgggctgaccgaaagccgggag
caggagaacagcgatgcgttatga

DBGET integrated database retrieval system