KEGG   Dictyoglomus thermophilum: DICTH_0332Help
Entry
DICTH_0332        CDS       T00774                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dth  Dictyoglomus thermophilum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DICTH_0332 (ppcA)
  Energy metabolism
   00680 Methane metabolism
    DICTH_0332 (ppcA)
Enzymes [BR:dth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DICTH_0332 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
337279..338772
Genome map
AA seq 497 aa AA seqDB search
MTRKIPRTMSTQHPDNANVPFFSNNPVLQGDDEIKEAYYAFSYLGVDEVMWDVEGKETDE
FVIRKLVSDYPEFFKQKVIGKDIFITLRVPNPNYEKAEGKLLIETLESIPRSYDTAYVFY
QDESVVPIFEVIVPMADTETCNRVYYYYKNVVAGKEDKPFCDTNPQLKLKDWIGEFRPKK
INVIPLFEDIDNIINVDKNLKEFLKDKLDEVEYQRVFLARSDPAMNYSSLSVIIAIKLAL
EKLYELQESLKLPIYPILGCGTAPFRGNFSPNTYRYVINNYPSVATFTIQSAFKYDFPVK
EVQRAIENINLTPVKSPNSISSKDRVESIMYKVSSEYKKQLAEIAPLVNNIAVFVPKRRA
RKIHVGLFGYSRQTDEGITLPRVISFCAVLYSLGLPPDILGLSALTDEDIKYVESVFPRF
KEEMSEILSMWNEDVLDLLPVSIRSEIKQTVKRFDFEINQEHLSFSKDLVKRIKENKFDT
KITDLIVASAKVRNFLG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaaatacctagaacaatgtcaacacagcatcctgataatgctaatgtacct
tttttctcaaataatcccgttcttcaaggtgatgatgaaataaaagaagcgtattatgct
ttttcatatcttggcgtggatgaggtgatgtgggatgttgaaggtaaggagacagatgag
tttgtaatcagaaaattggtatctgattatccagaattctttaaacaaaaagtaatagga
aaagatatatttataaccttaagggtaccaaatcctaattacgagaaagctgaaggtaaa
ttacttatagaaactcttgaaagtattcctaggtcttacgatacagcatatgtcttctac
caagatgaaagtgttgtacctatatttgaggttatagtgccaatggcagatactgagacc
tgtaacagagtgtactactactataagaatgtagttgctggtaaggaagataaaccgttt
tgtgacacaaatcctcagctaaaacttaaggattggattggagagtttagacccaaaaag
ataaatgttatacctctttttgaagatattgataatattatcaatgttgacaaaaatcta
aaggagtttctaaaggataaacttgatgaagttgaatatcagagggtgtttttagctaga
tctgatcctgcaatgaattattcttctttaagtgttataattgccataaagcttgctcta
gagaaactttatgaacttcaagaaagtttaaaactacctatttatcctatacttggctgt
ggtacagctccgtttagaggaaatttttcacctaatacctataggtatgttataaataat
tatcctagtgtagcaacatttaccatccagtcggcttttaaatatgatttcccagttaaa
gaagttcaaagagcaatagaaaatataaacttaactcctgtaaaatcaccaaattcaata
agttcaaaagacagagttgaaagtataatgtacaaagtttcttcggaatacaagaaacag
cttgctgaaattgcacctttagttaataatatagctgtttttgtaccaaaaagaagagct
aggaaaatacatgttggattgtttggttattcaagacaaactgatgaaggtataaccttg
ccaagagtaatttcgttttgtgctgttttatactctttgggattgcctccagatattcta
ggtcttagtgccttaacagatgaagatataaaatatgttgagtcggttttcccaaggttt
aaagaagaaatgtctgaaatattgtcaatgtggaatgaagatgttcttgatctacttcca
gttagcataaggagtgagataaagcaaacggtgaaaaggtttgactttgaaatcaaccaa
gaacatttatctttctcaaaggatcttgttaaacgaataaaggaaaataagtttgatacc
aaaatcactgatcttatagttgcatcagcaaaagtaagaaactttctaggttaa

DBGET integrated database retrieval system